BLASTP2 Result

of Bork Group Bork Group's Advanced BLAST2 Search Service at EMBL EMBL. back to BLAST2
BLASTP 2.0MP-WashU [16-Dec-1999] [irix6-r10k-L64 23:35:48 16-Dec-1999] Copyright (C) 1996-1999 Washington University, Saint Louis, Missouri USA. All Rights Reserved. Reference: Gish, W. (1996-1999) http://blast.wustl.edu Query= FTSA_ECOLI (420 letters) Database: pdb Release 8.Mar.2006 44,495 sequences; 10,202,976 total letters. Searching....10....20....30....40....50....60....70....80....90....100% done
Summary: Smallest Sum High Probability Sequences producing High-scoring Segment Pairs: Score P(N) N pdb|1E4F|1E4F-T FTSA (APO FORM) FROM THERMOTOGA MARITIMA 233 5.8e-18 1 pdb|1E4G|1E4G-T FTSA (ATP-BOUND FORM) FROM THERMOTOGA MAR... 233 5.8e-18 1 pdb|1JCE|1JCE-A MREB FROM THERMOTOGA MARITIMA 107 0.00066 1 pdb|1JCF|1JCF-A MREB FROM THERMOTOGA MARITIMA, TRIGONAL 107 0.00066 1 pdb|1JCG|1JCG-A MREB FROM THERMOTOGA MARITIMA, AMPPNP 107 0.00066 1 pdb|1WJU|1WJU-A SOLUTION STRUCTURE OF N-TERMINAL UBIQUITI... 62 0.97 1 pdb|1HY5|1HY5-A CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN... 66 0.98 1 pdb|2ABQ|2ABQ-A CRYSTAL STRUCTURE OF FRUCTOSE-1-PHOSPHATE... 62 0.997 2 pdb|1TA9|1TA9-A CRYSTAL STRUCTURE OF GLYCEROL DEHYDROGENA... 72 0.9992 1 pdb|1T6C|1T6C-A STRUCTURAL CHARACTERIZATION OF THE PPX/GP... 69 0.99992 1 pdb|1NEI|1NEI-A SOLUTION STRUCTURE OF HYPOTHETICAL PROTEI... 47 0.99995 1


Query sequence and locally-aligned HSPs from database sequences 0 90 180 270 360 | | | | | |420 FTSA_ECOLI | __________________________________________________ ^ v pdb|1E4F|1E4F-T | ______________________________________________ ^ v pdb|1E4G|1E4G-T | ______________________________________________ ^ v pdb|1JCE|1JCE-A | ____________________ ^ v pdb|1JCF|1JCF-A | ____________________ ^ v pdb|1JCG|1JCG-A | ____________________ ^ v pdb|1WJU|1WJU-A | ______ ^ v pdb|1HY5|1HY5-A | ___________ ^ v pdb|2ABQ|2ABQ-A | _____ ________ ^ v pdb|1TA9|1TA9-A | __________ ^ v pdb|1T6C|1T6C-A | ________ ^ v pdb|1NEI|1NEI-A | _____ Alignments: ^ = pdb|1E4F|1E4F-T FTSA (APO FORM) FROM THERMOTOGA MARITIMA Length = 419 0 90 180 270 360 | | | | | |419 pdb|1E4F|1E4F-T | __________________________________________________ Local hits (HSPs) | ______________________________________________ Score = 233 (87.1 bits), Expect = 5.8e-18, P = 5.8e-18 Identities = 82/392 (20%), Positives = 178/392 (45%) Query: 1 MIKATDRKLVVGLEIGTAKVAALV-GEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 MI + ++IG+ + LV G+ D + S SRG+D+G + D + + Sbjct: 1 MIDLSKTVFYTSIDIGSRYIKGLVLGK--RDQEWEALAFSSVKSRGLDEGEIKDAIAFKE 58 Query: 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVP--ISEEE--VTQEDVENVVHT 115 V + + E + S ++ +S +S + E ++ EE+ +T D+ + + + Sbjct: 59 SVNTLLKELEEQLQKSLRSDFV-ISFSSVSFEREDTVIERDFGEEKRSITL-DILSEMQS 116 Query: 116 AKSVRVRDEHRV-LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKA 174 ++++ + LH+ + Y +D + + NP+ + ++ + I + + Sbjct: 117 EALEKLKENGKTPLHIFSKRYLLDDERIVFNPLDMKASKIAIEYTSIVVPLKVYEMFYNF 176 Query: 175 VERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPY 234 ++ QL + ++++ VLT E++ GV VV++G + Y G +P Sbjct: 177 LQDTVKSPFQLKSSLVSTAEGVLTTPEKDRGVVVVNLGYNFTGLIAYKNGVPIKISYVPV 236 Query: 235 AGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLA 294 V D++ T ++E + + HG A+ + + K+E ++ + G ++ + L+ Sbjct: 237 GMKHVIKDVSAVLDTSFEESERLIITHGNAVYNDL-KEEEIQYRGLDGNTIKTTTAKKLS 295 Query: 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+++ + +++ K+ ++G + + G+VLTGG A+I + A VF + Sbjct: 296 VIIHARLREIMSKSKKFFREVEAKIVEEG-EIGIPGGVVLTGGGAKIPRINELATEVFKS 354 Query: 355 QVRIGAPLN-----ITGLTDYAQEPYYSTAVG 381 VR G N I + A +P ++ A G Sbjct: 355 PVRTGCYANSDRPSIINADEVANDPSFAAAFG 386 ^ = pdb|1E4G|1E4G-T FTSA (ATP-BOUND FORM) FROM THERMOTOGA MARITIMA Length = 419 0 90 180 270 360 | | | | | |419 pdb|1E4G|1E4G-T | __________________________________________________ Local hits (HSPs) | ______________________________________________ Score = 233 (87.1 bits), Expect = 5.8e-18, P = 5.8e-18 Identities = 82/392 (20%), Positives = 178/392 (45%) Query: 1 MIKATDRKLVVGLEIGTAKVAALV-GEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 MI + ++IG+ + LV G+ D + S SRG+D+G + D + + Sbjct: 1 MIDLSKTVFYTSIDIGSRYIKGLVLGK--RDQEWEALAFSSVKSRGLDEGEIKDAIAFKE 58 Query: 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVP--ISEEE--VTQEDVENVVHT 115 V + + E + S ++ +S +S + E ++ EE+ +T D+ + + + Sbjct: 59 SVNTLLKELEEQLQKSLRSDFV-ISFSSVSFEREDTVIERDFGEEKRSITL-DILSEMQS 116 Query: 116 AKSVRVRDEHRV-LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKA 174 ++++ + LH+ + Y +D + + NP+ + ++ + I + + Sbjct: 117 EALEKLKENGKTPLHIFSKRYLLDDERIVFNPLDMKASKIAIEYTSIVVPLKVYEMFYNF 176 Query: 175 VERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPY 234 ++ QL + ++++ VLT E++ GV VV++G + Y G +P Sbjct: 177 LQDTVKSPFQLKSSLVSTAEGVLTTPEKDRGVVVVNLGYNFTGLIAYKNGVPIKISYVPV 236 Query: 235 AGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLA 294 V D++ T ++E + + HG A+ + + K+E ++ + G ++ + L+ Sbjct: 237 GMKHVIKDVSAVLDTSFEESERLIITHGNAVYNDL-KEEEIQYRGLDGNTIKTTTAKKLS 295 Query: 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+++ + +++ K+ ++G + + G+VLTGG A+I + A VF + Sbjct: 296 VIIHARLREIMSKSKKFFREVEAKIVEEG-EIGIPGGVVLTGGGAKIPRINELATEVFKS 354 Query: 355 QVRIGAPLN-----ITGLTDYAQEPYYSTAVG 381 VR G N I + A +P ++ A G Sbjct: 355 PVRTGCYANSDRPSIINADEVANDPSFAAAFG 386 ^ = pdb|1JCE|1JCE-A MREB FROM THERMOTOGA MARITIMA Length = 344 0 70 140 210 280 | | | | | |344 pdb|1JCE|1JCE-A | __________________________________________________ Local hits (HSPs) | ________________________ Score = 107 (42.7 bits), Expect = 0.00066, P = 0.00066 Identities = 49/178 (27%), Positives = 81/178 (45%) Query: 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 +++ + A + S+ +V E G VVDIGGGT ++AV + G++ + I AG+ + Sbjct: 129 IEEPMAAAIGSNLNV----EEPSGNMVVDIGGGTTEVAVISLGSIVTWESIRIAGDEMDE 184 Query: 242 DIA------YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQ-TL- 293 I Y AE +K+ G S +++ +E G L R+ TL Sbjct: 185 AIVQYVRETYRVAIGERTAERVKIEIGNVFPS--KENDELETTVSGIDLSTGLPRKLTLK 242 Query: 294 -AEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQR 350 EV E + ++ +V E + EK + V + GI LTGG + + GL Q+ Sbjct: 243 GGEVREALRSVVVAIV-ESVRTTLEKTPPELVSDIIERGIFLTGGGSLLRGLDTLLQK 299 ^ = pdb|1JCF|1JCF-A MREB FROM THERMOTOGA MARITIMA, TRIGONAL Length = 344 0 70 140 210 280 | | | | | |344 pdb|1JCF|1JCF-A | __________________________________________________ Local hits (HSPs) | ________________________ Score = 107 (42.7 bits), Expect = 0.00066, P = 0.00066 Identities = 49/178 (27%), Positives = 81/178 (45%) Query: 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 +++ + A + S+ +V E G VVDIGGGT ++AV + G++ + I AG+ + Sbjct: 129 IEEPMAAAIGSNLNV----EEPSGNMVVDIGGGTTEVAVISLGSIVTWESIRIAGDEMDE 184 Query: 242 DIA------YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQ-TL- 293 I Y AE +K+ G S +++ +E G L R+ TL Sbjct: 185 AIVQYVRETYRVAIGERTAERVKIEIGNVFPS--KENDELETTVSGIDLSTGLPRKLTLK 242 Query: 294 -AEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQR 350 EV E + ++ +V E + EK + V + GI LTGG + + GL Q+ Sbjct: 243 GGEVREALRSVVVAIV-ESVRTTLEKTPPELVSDIIERGIFLTGGGSLLRGLDTLLQK 299 ^ = pdb|1JCG|1JCG-A MREB FROM THERMOTOGA MARITIMA, AMPPNP Length = 344 0 70 140 210 280 | | | | | |344 pdb|1JCG|1JCG-A | __________________________________________________ Local hits (HSPs) | ________________________ Score = 107 (42.7 bits), Expect = 0.00066, P = 0.00066 Identities = 49/178 (27%), Positives = 81/178 (45%) Query: 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 +++ + A + S+ +V E G VVDIGGGT ++AV + G++ + I AG+ + Sbjct: 129 IEEPMAAAIGSNLNV----EEPSGNMVVDIGGGTTEVAVISLGSIVTWESIRIAGDEMDE 184 Query: 242 DIA------YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQ-TL- 293 I Y AE +K+ G S +++ +E G L R+ TL Sbjct: 185 AIVQYVRETYRVAIGERTAERVKIEIGNVFPS--KENDELETTVSGIDLSTGLPRKLTLK 242 Query: 294 -AEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQR 350 EV E + ++ +V E + EK + V + GI LTGG + + GL Q+ Sbjct: 243 GGEVREALRSVVVAIV-ESVRTTLEKTPPELVSDIIERGIFLTGGGSLLRGLDTLLQK 299 ^ = pdb|1WJU|1WJU-A SOLUTION STRUCTURE OF N-TERMINAL UBIQUITIN-LIKE DOMAIN OF HUMAN NEDD8 ULTIMATE BUSTER-1 Length = 100 0 20 40 60 80 100 | | | | | |100 pdb|1WJU|1WJU-A | __________________________________________________ Local hits (HSPs) | ________________________ Score = 62 (26.9 bits), Expect = 3.6, P = 0.97 Identities = 16/54 (29%), Positives = 32/54 (59%) Query: 280 VGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIV 333 + GR RS +T ++ Y +++ +N++ LQL + L +QGV H++ A ++ Sbjct: 40 ITGRELRSKIAETFG--LQENYIKIV--INKKQLQLGKTLEEQGVAHNVKAMVL 89 ^ = pdb|1HY5|1HY5-A CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF YOPE-YERSINIA PESTIS GAP EFFECTOR PROTEIN. Length = 136 0 30 60 90 120 | | | | | |136 pdb|1HY5|1HY5-A | __________________________________________________ Local hits (HSPs) | ___________________________________ Score = 66 (28.3 bits), Expect = 4.1, P = 0.98 Identities = 29/101 (28%), Positives = 41/101 (40%) Query: 290 RQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEG--LAAC 347 +Q AE + P+Y + LN ++ E+LQ G L I G Q G L A Sbjct: 18 KQLAAETL-PKYMQQLNSLDAEMLQKNHDQFATG-SGPLRGSITQCQGLMQFCGGELQAE 75 Query: 348 AQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKE 388 A + +T V G P + G A Y ++ V L E Sbjct: 76 ASAILNTPV-CGIPFSQWGTIGGAASAYVASGVDLTQAANE 115 ^ = pdb|2ABQ|2ABQ-A CRYSTAL STRUCTURE OF FRUCTOSE-1-PHOSPHATE KINASE FROM BACILLUS HALODURANS Length = 306 0 70 140 210 280 | | | | | |306 pdb|2ABQ|2ABQ-A | __________________________________________________ Local hits (HSPs) | _______ ___________ Score = 62 (26.9 bits), Expect = 5.9, Sum P(2) = 1.0 Identities = 22/75 (29%), Positives = 35/75 (46%) Query: 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGI--VLTGGAAQIEGLAACAQRVFHT 354 I+P + EL LV++ I +++ + V+ + GI +L A L A A+ +FH Sbjct: 178 IKPNHHELSELVSKPIASIEDAIPH--VQRLIGEGIESILVSFAGD-GALFASAEGMFHV 234 Query: 355 QVRIGAPLNITGLTD 369 V G N G D Sbjct: 235 NVPSGEVRNSVGAGD 249 Score = 48 (22.0 bits), Expect = 5.9, Sum P(2) = 1.0 Identities = 11/47 (23%), Positives = 24/47 (51%) Query: 170 NIVKAVERCGLKVDQLIF-AGLASSYSVLTEDERELGVCVVDIGGGT 215 N+ + ++R G + L F G +Y ++ E+G+ +++ G T Sbjct: 41 NVSRVLKRLGHETKALGFLGGFTGAYVRNALEKEEIGLSFIEVEGDT 87 ^ = pdb|1TA9|1TA9-A CRYSTAL STRUCTURE OF GLYCEROL DEHYDROGENASE FROM SCHIZOSACCHAROMYCES POMBE Length = 450 0 90 180 270 360 450 | | | | | |450 pdb|1TA9|1TA9-A | __________________________________________________ Local hits (HSPs) | __________ Score = 72 (30.4 bits), Expect = 7.1, P = 1.0 Identities = 26/92 (28%), Positives = 46/92 (50%) Query: 165 NDMAKNIVKAVERCGLKVDQLIFAGLASSYSV--LTEDERELGVCVVDIGGG-TMDIAVY 221 N A IV ++ + G+ V +L+F G AS + L + + ++ +GGG TMD A Y Sbjct: 104 NICANKIVDSLSQNGMTVTKLVFGGEASLVELDKLRKQCPDDTQVIIGVGGGKTMDSAKY 163 Query: 222 TGGALRHTKVI-PY--AGNVVTSDIAYAFGTP 250 ++ +I P + + TS ++ + TP Sbjct: 164 IAHSMNLPSIICPTTASSDAATSSLSVIY-TP 194 ^ = pdb|1T6C|1T6C-A STRUCTURAL CHARACTERIZATION OF THE PPX/GPPA PROTEIN FAMILY: CRYSTAL STRUCTURE OF THE AQUIFEX AEOLICUS FAMILY MEMBER Length = 315 0 70 140 210 280 | | | | | |315 pdb|1T6C|1T6C-A | __________________________________________________ Local hits (HSPs) | _________ Score = 69 (29.3 bits), Expect = 9.4, P = 1.0 Identities = 22/69 (31%), Positives = 33/69 (47%) Query: 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 +A LA +YS+ E E VCVVD GGG+ + G +R +P +V + Sbjct: 125 YAYLAVAYSLKPEGE----VCVVDQGGGSTEYVFGKGYKVREVISLPIG--IVNLTETFF 178 Query: 247 FGTPPSDAE 255 PP++ E Sbjct: 179 KQDPPTEEE 187 ^ = pdb|1NEI|1NEI-A SOLUTION STRUCTURE OF HYPOTHETICAL PROTEIN DIMER ENCODED BY THE YOAG GENE FROM ESCHERICHIA COLI. ONTARIO CENTRE FOR STRUCTURAL PROTEOMICS TARGET EC0264_1_60; NORTHEAST STRUCTURAL GENOMICS TARGET ET94. Length = 60 0 20 40 60 | | | |60 pdb|1NEI|1NEI-A | __________________________________________________ Local hits (HSPs) | ____________________________________ Score = 47 (21.6 bits), Expect = 9.9, P = 1.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Query: 84 SGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRV 127 +G + + E M + EV E ++++V+T +S +EH V Sbjct: 15 NGVSVDYETETPMT-LLVPEVAAEVIKDLVNTVRSYDTENEHDV 57 Parameters: matrix=BLOSUM62 E=10 V=50 B=50 hspmax=10 filter=none echofilter stats qtype qres ctxfactor=1.00 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H +0 0 BLOSUM62 0.317 0.135 0.386 same same same Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +0 0 420 420 10. 69 3 11 22 0.21 34 34 0.22 37 Statistics: Query Expected Observed HSPs HSPs Frame MatID High Score High Score Reportable Reported +0 0 63 (28.8 bits) 83 (38.0 bits) 12 12 Query Neighborhd Word Excluded Failed Successful Overlaps Frame MatID Words Hits Hits Extensions Extensions Excluded +0 0 8686 8581399 1751960 6817155 12284 3 Database: /dove2/data/db/pdb Title: pdb Release 8.Mar.2006 Release date: 8.Mar.2006 Posted date: 11:06:54 PM MET Mar 8, 2006 Last modified: unknown First created: unknown Format: BLAST-1.4 # of letters in database: 10,202,976 # of sequences in database: 44,495 # of database sequences satisfying E: 11 No. of states in DFA: 563 (110 KB) Total size of DFA: 291 KB (320 KB) Time to generate neighborhood: 0.01u 0.00s 0.01t Elapsed: 00:00:00 No. of threads or processors used: 4 Search cpu time: 20.80u 0.30s 21.10t Elapsed: 00:00:10 Total cpu time: 20.86u 0.36s 21.22t Elapsed: 00:00:10 Start: Fri Mar 10 14:00:08 2006 End: Fri Mar 10 14:00:18 2006

Your commentYour comment is highly appreciated! Thanks