CLUSTALW Result

[clustalw.aln][clustalw.dnd][readme]



 CLUSTAL W (1.83) Multiple Sequence Alignments



Sequence type explicitly set to Protein
Sequence format is Pearson
Sequence 1: sw|P49298|CISY_CITMA_Citrate_s      471 aa
Sequence 2: sw|Q9HHB9|DNAK_HALME_Chaperone      625 aa
Sequence 3: sw|Q7NAU6|DNAK_MYCGA_Chaperone      595 aa
Sequence 4: sw|P75344|DNAK_MYCPN_Chaperone      595 aa
Sequence 5: sw|Q8EPW4|DNAK_OCEIH_Chaperone      612 aa
Sequence 6: sw|Q9ZAD3|DNAK_PORGI_Chaperone      640 aa
Sequence 7: sw|Q9XCB1|DNAK_RHOMR_Chaperone      640 aa
Sequence 8: sw|Q9WYK6|DNAK_THEMA_Chaperone      596 aa
Sequence 9: sw|P0A331|FTSA_AGRT5_Cell_divi      443 aa
Sequence 10: sw|P0A332|FTSA_AGRTU_Cell_divi      443 aa
Sequence 11: sw|P28264|FTSA_BACSU_Cell_divi      440 aa
Sequence 12: sw|Q44774|FTSA_BORBU_Cell_divi      413 aa
Sequence 13: sw|P57309|FTSA_BUCAI_Cell_divi      418 aa
Sequence 14: sw|O51928|FTSA_BUCAP_Cell_divi      418 aa
Sequence 15: sw|Q89AQ4|FTSA_BUCBP_Cell_divi      421 aa
Sequence 16: sw|P0ABH2|FTSA_ECO57_Cell_divi      420 aa
Sequence 17: sw|P0ABH1|FTSA_ECOL6_Cell_divi      420 aa
Sequence 18: sw|P0ABH0|FTSA_ECOLI_Cell_divi      420 aa
Sequence 19: sw|O07111|FTSA_ENTFA_Cell_divi      440 aa
Sequence 20: sw|O07672|FTSA_ENTHR_Cell_divi      442 aa
Sequence 21: sw|P45068|FTSA_HAEIN_Cell_divi      425 aa
Sequence 22: sw|Q9ZKM3|FTSA_HELPJ_Cell_divi      493 aa
Sequence 23: sw|O25629|FTSA_HELPY_Cell_divi      492 aa
Sequence 24: sw|O07827|FTSA_PORGI_Cell_divi      479 aa
Sequence 25: sw|P47203|FTSA_PSEAE_Cell_divi      417 aa
Sequence 26: sw|O30994|FTSA_RHIME_Cell_divi      442 aa
Sequence 27: sw|P0ABH3|FTSA_SHIFL_Cell_divi      439 aa
Sequence 28: sw|Q5HGP6|FTSA_STAAC_Cell_divi      470 aa
Sequence 29: sw|P63764|FTSA_STAAM_Cell_divi      470 aa
Sequence 30: sw|P63765|FTSA_STAAN_Cell_divi      470 aa
Sequence 31: sw|Q6GHQ0|FTSA_STAAR_Cell_divi      468 aa
Sequence 32: sw|Q6GA27|FTSA_STAAS_Cell_divi      470 aa
Sequence 33: sw|O07325|FTSA_STAAU_Cell_divi      471 aa
Sequence 34: sw|Q8NX33|FTSA_STAAW_Cell_divi      470 aa
Sequence 35: sw|Q5HQ07|FTSA_STAEQ_Cell_divi      464 aa
Sequence 36: sw|Q8CPK5|FTSA_STAES_Cell_divi      464 aa
Sequence 37: sw|Q51382|HSCA_PSEAE_Chaperone      619 aa
Sequence 38: sw|Q886Z7|HSCA_PSESM_Chaperone      620 aa
Sequence 39: sw|Q8Y0L9|HSCA_RALSO_Chaperone      621 aa
Sequence 40: sw|P32444|MBL_BACC1_MreB-like_      333 aa
Sequence 41: sw|P39751|MBL_BACSU_MreB-like_      333 aa
Sequence 42: sw|P39763|MREBH_BACSU_Protein_      335 aa
Sequence 43: sw|Q01465|MREB_BACSU_Rod_shape      337 aa
Sequence 44: sw|P0A9X5|MREB_ECOL6_Rod_shape      347 aa
Sequence 45: sw|P0A9X4|MREB_ECOLI_Rod_shape      347 aa
Sequence 46: sw|P44474|MREB_HAEIN_Rod_shape      351 aa
Sequence 47: sw|Q9L6A3|MREB_PASMU_Rod_shape      351 aa
Sequence 48: sw|P0A9X7|MREB_SALTI_Rod_shape      347 aa
Sequence 49: sw|P0A9X6|MREB_SALTY_Rod_shape      347 aa
Sequence 50: sw|P0A9X8|MREB_SHIFL_Rod_shape      347 aa
Start of Pairwise alignments
Aligning...
Sequences (1:2) Aligned. Score:  7
Sequences (1:3) Aligned. Score:  8
Sequences (1:4) Aligned. Score:  1
Sequences (1:5) Aligned. Score:  7
Sequences (1:6) Aligned. Score:  5
Sequences (1:7) Aligned. Score:  6
Sequences (1:8) Aligned. Score:  7
Sequences (1:9) Aligned. Score:  11
Sequences (1:10) Aligned. Score:  11
Sequences (1:11) Aligned. Score:  7
Sequences (1:12) Aligned. Score:  16
Sequences (1:13) Aligned. Score:  10
Sequences (1:14) Aligned. Score:  9
Sequences (1:15) Aligned. Score:  7
Sequences (1:16) Aligned. Score:  11
Sequences (1:17) Aligned. Score:  11
Sequences (1:18) Aligned. Score:  11
Sequences (1:19) Aligned. Score:  6
Sequences (1:20) Aligned. Score:  11
Sequences (1:21) Aligned. Score:  9
Sequences (1:22) Aligned. Score:  5
Sequences (1:23) Aligned. Score:  11
Sequences (1:24) Aligned. Score:  5
Sequences (1:25) Aligned. Score:  8
Sequences (1:26) Aligned. Score:  10
Sequences (1:27) Aligned. Score:  10
Sequences (1:28) Aligned. Score:  3
Sequences (1:29) Aligned. Score:  3
Sequences (1:30) Aligned. Score:  3
Sequences (1:31) Aligned. Score:  3
Sequences (1:32) Aligned. Score:  4
Sequences (1:33) Aligned. Score:  4
Sequences (1:34) Aligned. Score:  4
Sequences (1:35) Aligned. Score:  4
Sequences (1:36) Aligned. Score:  4
Sequences (1:37) Aligned. Score:  11
Sequences (1:38) Aligned. Score:  9
Sequences (1:39) Aligned. Score:  5
Sequences (1:40) Aligned. Score:  9
Sequences (1:41) Aligned. Score:  11
Sequences (1:42) Aligned. Score:  8
Sequences (1:43) Aligned. Score:  14
Sequences (1:44) Aligned. Score:  11
Sequences (1:45) Aligned. Score:  11
Sequences (1:46) Aligned. Score:  10
Sequences (1:47) Aligned. Score:  9
Sequences (1:48) Aligned. Score:  11
Sequences (1:49) Aligned. Score:  11
Sequences (1:50) Aligned. Score:  11
Sequences (2:3) Aligned. Score:  47
Sequences (2:4) Aligned. Score:  49
Sequences (2:5) Aligned. Score:  57
Sequences (2:6) Aligned. Score:  55
Sequences (2:7) Aligned. Score:  56
Sequences (2:8) Aligned. Score:  56
Sequences (2:9) Aligned. Score:  14
Sequences (2:10) Aligned. Score:  14
Sequences (2:11) Aligned. Score:  17
Sequences (2:12) Aligned. Score:  15
Sequences (2:13) Aligned. Score:  11
Sequences (2:14) Aligned. Score:  10
Sequences (2:15) Aligned. Score:  13
Sequences (2:16) Aligned. Score:  9
Sequences (2:17) Aligned. Score:  9
Sequences (2:18) Aligned. Score:  9
Sequences (2:19) Aligned. Score:  14
Sequences (2:20) Aligned. Score:  17
Sequences (2:21) Aligned. Score:  15
Sequences (2:22) Aligned. Score:  10
Sequences (2:23) Aligned. Score:  10
Sequences (2:24) Aligned. Score:  11
Sequences (2:25) Aligned. Score:  15
Sequences (2:26) Aligned. Score:  15
Sequences (2:27) Aligned. Score:  9
Sequences (2:28) Aligned. Score:  14
Sequences (2:29) Aligned. Score:  14
Sequences (2:30) Aligned. Score:  14
Sequences (2:31) Aligned. Score:  15
Sequences (2:32) Aligned. Score:  14
Sequences (2:33) Aligned. Score:  15
Sequences (2:34) Aligned. Score:  14
Sequences (2:35) Aligned. Score:  15
Sequences (2:36) Aligned. Score:  15
Sequences (2:37) Aligned. Score:  36
Sequences (2:38) Aligned. Score:  36
Sequences (2:39) Aligned. Score:  37
Sequences (2:40) Aligned. Score:  22
Sequences (2:41) Aligned. Score:  22
Sequences (2:42) Aligned. Score:  19
Sequences (2:43) Aligned. Score:  21
Sequences (2:44) Aligned. Score:  19
Sequences (2:45) Aligned. Score:  19
Sequences (2:46) Aligned. Score:  20
Sequences (2:47) Aligned. Score:  22
Sequences (2:48) Aligned. Score:  19
Sequences (2:49) Aligned. Score:  19
Sequences (2:50) Aligned. Score:  19
Sequences (3:4) Aligned. Score:  78
Sequences (3:5) Aligned. Score:  55
Sequences (3:6) Aligned. Score:  51
Sequences (3:7) Aligned. Score:  51
Sequences (3:8) Aligned. Score:  52
Sequences (3:9) Aligned. Score:  11
Sequences (3:10) Aligned. Score:  11
Sequences (3:11) Aligned. Score:  15
Sequences (3:12) Aligned. Score:  15
Sequences (3:13) Aligned. Score:  12
Sequences (3:14) Aligned. Score:  12
Sequences (3:15) Aligned. Score:  13
Sequences (3:16) Aligned. Score:  13
Sequences (3:17) Aligned. Score:  13
Sequences (3:18) Aligned. Score:  13
Sequences (3:19) Aligned. Score:  13
Sequences (3:20) Aligned. Score:  10
Sequences (3:21) Aligned. Score:  9
Sequences (3:22) Aligned. Score:  9
Sequences (3:23) Aligned. Score:  9
Sequences (3:24) Aligned. Score:  13
Sequences (3:25) Aligned. Score:  16
Sequences (3:26) Aligned. Score:  9
Sequences (3:27) Aligned. Score:  13
Sequences (3:28) Aligned. Score:  12
Sequences (3:29) Aligned. Score:  12
Sequences (3:30) Aligned. Score:  12
Sequences (3:31) Aligned. Score:  8
Sequences (3:32) Aligned. Score:  12
Sequences (3:33) Aligned. Score:  8
Sequences (3:34) Aligned. Score:  12
Sequences (3:35) Aligned. Score:  11
Sequences (3:36) Aligned. Score:  12
Sequences (3:37) Aligned. Score:  36
Sequences (3:38) Aligned. Score:  35
Sequences (3:39) Aligned. Score:  36
Sequences (3:40) Aligned. Score:  20
Sequences (3:41) Aligned. Score:  22
Sequences (3:42) Aligned. Score:  22
Sequences (3:43) Aligned. Score:  21
Sequences (3:44) Aligned. Score:  19
Sequences (3:45) Aligned. Score:  19
Sequences (3:46) Aligned. Score:  14
Sequences (3:47) Aligned. Score:  18
Sequences (3:48) Aligned. Score:  19
Sequences (3:49) Aligned. Score:  19
Sequences (3:50) Aligned. Score:  19
Sequences (4:5) Aligned. Score:  54
Sequences (4:6) Aligned. Score:  50
Sequences (4:7) Aligned. Score:  50
Sequences (4:8) Aligned. Score:  49
Sequences (4:9) Aligned. Score:  8
Sequences (4:10) Aligned. Score:  8
Sequences (4:11) Aligned. Score:  14
Sequences (4:12) Aligned. Score:  17
Sequences (4:13) Aligned. Score:  14
Sequences (4:14) Aligned. Score:  13
Sequences (4:15) Aligned. Score:  12
Sequences (4:16) Aligned. Score:  16
Sequences (4:17) Aligned. Score:  16
Sequences (4:18) Aligned. Score:  16
Sequences (4:19) Aligned. Score:  14
Sequences (4:20) Aligned. Score:  13
Sequences (4:21) Aligned. Score:  10
Sequences (4:22) Aligned. Score:  13
Sequences (4:23) Aligned. Score:  15
Sequences (4:24) Aligned. Score:  12
Sequences (4:25) Aligned. Score:  14
Sequences (4:26) Aligned. Score:  9
Sequences (4:27) Aligned. Score:  15
Sequences (4:28) Aligned. Score:  11
Sequences (4:29) Aligned. Score:  11
Sequences (4:30) Aligned. Score:  11
Sequences (4:31) Aligned. Score:  11
Sequences (4:32) Aligned. Score:  11
Sequences (4:33) Aligned. Score:  7
Sequences (4:34) Aligned. Score:  11
Sequences (4:35) Aligned. Score:  13
Sequences (4:36) Aligned. Score:  12
Sequences (4:37) Aligned. Score:  37
Sequences (4:38) Aligned. Score:  36
Sequences (4:39) Aligned. Score:  36
Sequences (4:40) Aligned. Score:  20
Sequences (4:41) Aligned. Score:  23
Sequences (4:42) Aligned. Score:  22
Sequences (4:43) Aligned. Score:  21
Sequences (4:44) Aligned. Score:  19
Sequences (4:45) Aligned. Score:  19
Sequences (4:46) Aligned. Score:  17
Sequences (4:47) Aligned. Score:  20
Sequences (4:48) Aligned. Score:  19
Sequences (4:49) Aligned. Score:  19
Sequences (4:50) Aligned. Score:  19
Sequences (5:6) Aligned. Score:  59
Sequences (5:7) Aligned. Score:  57
Sequences (5:8) Aligned. Score:  54
Sequences (5:9) Aligned. Score:  13
Sequences (5:10) Aligned. Score:  13
Sequences (5:11) Aligned. Score:  16
Sequences (5:12) Aligned. Score:  15
Sequences (5:13) Aligned. Score:  11
Sequences (5:14) Aligned. Score:  9
Sequences (5:15) Aligned. Score:  13
Sequences (5:16) Aligned. Score:  11
Sequences (5:17) Aligned. Score:  11
Sequences (5:18) Aligned. Score:  11
Sequences (5:19) Aligned. Score:  14
Sequences (5:20) Aligned. Score:  14
Sequences (5:21) Aligned. Score:  12
Sequences (5:22) Aligned. Score:  10
Sequences (5:23) Aligned. Score:  11
Sequences (5:24) Aligned. Score:  11
Sequences (5:25) Aligned. Score:  15
Sequences (5:26) Aligned. Score:  15
Sequences (5:27) Aligned. Score:  11
Sequences (5:28) Aligned. Score:  8
Sequences (5:29) Aligned. Score:  8
Sequences (5:30) Aligned. Score:  8
Sequences (5:31) Aligned. Score:  8
Sequences (5:32) Aligned. Score:  8
Sequences (5:33) Aligned. Score:  12
Sequences (5:34) Aligned. Score:  8
Sequences (5:35) Aligned. Score:  9
Sequences (5:36) Aligned. Score:  9
Sequences (5:37) Aligned. Score:  36
Sequences (5:38) Aligned. Score:  37
Sequences (5:39) Aligned. Score:  38
Sequences (5:40) Aligned. Score:  21
Sequences (5:41) Aligned. Score:  21
Sequences (5:42) Aligned. Score:  25
Sequences (5:43) Aligned. Score:  19
Sequences (5:44) Aligned. Score:  19
Sequences (5:45) Aligned. Score:  19
Sequences (5:46) Aligned. Score:  19
Sequences (5:47) Aligned. Score:  20
Sequences (5:48) Aligned. Score:  19
Sequences (5:49) Aligned. Score:  19
Sequences (5:50) Aligned. Score:  19
Sequences (6:7) Aligned. Score:  67
Sequences (6:8) Aligned. Score:  54
Sequences (6:9) Aligned. Score:  13
Sequences (6:10) Aligned. Score:  13
Sequences (6:11) Aligned. Score:  17
Sequences (6:12) Aligned. Score:  12
Sequences (6:13) Aligned. Score:  8
Sequences (6:14) Aligned. Score:  8
Sequences (6:15) Aligned. Score:  16
Sequences (6:16) Aligned. Score:  9
Sequences (6:17) Aligned. Score:  9
Sequences (6:18) Aligned. Score:  9
Sequences (6:19) Aligned. Score:  14
Sequences (6:20) Aligned. Score:  15
Sequences (6:21) Aligned. Score:  13
Sequences (6:22) Aligned. Score:  12
Sequences (6:23) Aligned. Score:  16
Sequences (6:24) Aligned. Score:  8
Sequences (6:25) Aligned. Score:  13
Sequences (6:26) Aligned. Score:  15
Sequences (6:27) Aligned. Score:  8
Sequences (6:28) Aligned. Score:  13
Sequences (6:29) Aligned. Score:  13
Sequences (6:30) Aligned. Score:  13
Sequences (6:31) Aligned. Score:  15
Sequences (6:32) Aligned. Score:  13
Sequences (6:33) Aligned. Score:  12
Sequences (6:34) Aligned. Score:  13
Sequences (6:35) Aligned. Score:  12
Sequences (6:36) Aligned. Score:  13
Sequences (6:37) Aligned. Score:  37
Sequences (6:38) Aligned. Score:  38
Sequences (6:39) Aligned. Score:  39
Sequences (6:40) Aligned. Score:  22
Sequences (6:41) Aligned. Score:  22
Sequences (6:42) Aligned. Score:  20
Sequences (6:43) Aligned. Score:  17
Sequences (6:44) Aligned. Score:  19
Sequences (6:45) Aligned. Score:  19
Sequences (6:46) Aligned. Score:  19
Sequences (6:47) Aligned. Score:  22
Sequences (6:48) Aligned. Score:  19
Sequences (6:49) Aligned. Score:  19
Sequences (6:50) Aligned. Score:  19
Sequences (7:8) Aligned. Score:  58
Sequences (7:9) Aligned. Score:  12
Sequences (7:10) Aligned. Score:  12
Sequences (7:11) Aligned. Score:  16
Sequences (7:12) Aligned. Score:  16
Sequences (7:13) Aligned. Score:  12
Sequences (7:14) Aligned. Score:  14
Sequences (7:15) Aligned. Score:  15
Sequences (7:16) Aligned. Score:  17
Sequences (7:17) Aligned. Score:  17
Sequences (7:18) Aligned. Score:  17
Sequences (7:19) Aligned. Score:  14
Sequences (7:20) Aligned. Score:  16
Sequences (7:21) Aligned. Score:  14
Sequences (7:22) Aligned. Score:  15
Sequences (7:23) Aligned. Score:  11
Sequences (7:24) Aligned. Score:  8
Sequences (7:25) Aligned. Score:  17
Sequences (7:26) Aligned. Score:  14
Sequences (7:27) Aligned. Score:  16
Sequences (7:28) Aligned. Score:  12
Sequences (7:29) Aligned. Score:  12
Sequences (7:30) Aligned. Score:  12
Sequences (7:31) Aligned. Score:  15
Sequences (7:32) Aligned. Score:  12
Sequences (7:33) Aligned. Score:  15
Sequences (7:34) Aligned. Score:  12
Sequences (7:35) Aligned. Score:  15
Sequences (7:36) Aligned. Score:  15
Sequences (7:37) Aligned. Score:  41
Sequences (7:38) Aligned. Score:  41
Sequences (7:39) Aligned. Score:  39
Sequences (7:40) Aligned. Score:  22
Sequences (7:41) Aligned. Score:  22
Sequences (7:42) Aligned. Score:  21
Sequences (7:43) Aligned. Score:  22
Sequences (7:44) Aligned. Score:  20
Sequences (7:45) Aligned. Score:  20
Sequences (7:46) Aligned. Score:  19
Sequences (7:47) Aligned. Score:  21
Sequences (7:48) Aligned. Score:  20
Sequences (7:49) Aligned. Score:  20
Sequences (7:50) Aligned. Score:  20
Sequences (8:9) Aligned. Score:  12
Sequences (8:10) Aligned. Score:  12
Sequences (8:11) Aligned. Score:  16
Sequences (8:12) Aligned. Score:  11
Sequences (8:13) Aligned. Score:  9
Sequences (8:14) Aligned. Score:  15
Sequences (8:15) Aligned. Score:  12
Sequences (8:16) Aligned. Score:  14
Sequences (8:17) Aligned. Score:  14
Sequences (8:18) Aligned. Score:  14
Sequences (8:19) Aligned. Score:  14
Sequences (8:20) Aligned. Score:  13
Sequences (8:21) Aligned. Score:  5
Sequences (8:22) Aligned. Score:  11
Sequences (8:23) Aligned. Score:  11
Sequences (8:24) Aligned. Score:  11
Sequences (8:25) Aligned. Score:  16
Sequences (8:26) Aligned. Score:  11
Sequences (8:27) Aligned. Score:  14
Sequences (8:28) Aligned. Score:  12
Sequences (8:29) Aligned. Score:  12
Sequences (8:30) Aligned. Score:  12
Sequences (8:31) Aligned. Score:  12
Sequences (8:32) Aligned. Score:  12
Sequences (8:33) Aligned. Score:  12
Sequences (8:34) Aligned. Score:  12
Sequences (8:35) Aligned. Score:  10
Sequences (8:36) Aligned. Score:  12
Sequences (8:37) Aligned. Score:  37
Sequences (8:38) Aligned. Score:  36
Sequences (8:39) Aligned. Score:  39
Sequences (8:40) Aligned. Score:  22
Sequences (8:41) Aligned. Score:  20
Sequences (8:42) Aligned. Score:  19
Sequences (8:43) Aligned. Score:  22
Sequences (8:44) Aligned. Score:  17
Sequences (8:45) Aligned. Score:  17
Sequences (8:46) Aligned. Score:  19
Sequences (8:47) Aligned. Score:  19
Sequences (8:48) Aligned. Score:  17
Sequences (8:49) Aligned. Score:  17
Sequences (8:50) Aligned. Score:  17
Sequences (9:10) Aligned. Score:  100
Sequences (9:11) Aligned. Score:  27
Sequences (9:12) Aligned. Score:  26
Sequences (9:13) Aligned. Score:  27
Sequences (9:14) Aligned. Score:  28
Sequences (9:15) Aligned. Score:  23
Sequences (9:16) Aligned. Score:  29
Sequences (9:17) Aligned. Score:  29
Sequences (9:18) Aligned. Score:  29
Sequences (9:19) Aligned. Score:  25
Sequences (9:20) Aligned. Score:  24
Sequences (9:21) Aligned. Score:  25
Sequences (9:22) Aligned. Score:  25
Sequences (9:23) Aligned. Score:  25
Sequences (9:24) Aligned. Score:  14
Sequences (9:25) Aligned. Score:  32
Sequences (9:26) Aligned. Score:  85
Sequences (9:27) Aligned. Score:  28
Sequences (9:28) Aligned. Score:  21
Sequences (9:29) Aligned. Score:  21
Sequences (9:30) Aligned. Score:  21
Sequences (9:31) Aligned. Score:  21
Sequences (9:32) Aligned. Score:  21
Sequences (9:33) Aligned. Score:  20
Sequences (9:34) Aligned. Score:  21
Sequences (9:35) Aligned. Score:  19
Sequences (9:36) Aligned. Score:  19
Sequences (9:37) Aligned. Score:  16
Sequences (9:38) Aligned. Score:  11
Sequences (9:39) Aligned. Score:  12
Sequences (9:40) Aligned. Score:  12
Sequences (9:41) Aligned. Score:  16
Sequences (9:42) Aligned. Score:  13
Sequences (9:43) Aligned. Score:  11
Sequences (9:44) Aligned. Score:  12
Sequences (9:45) Aligned. Score:  12
Sequences (9:46) Aligned. Score:  16
Sequences (9:47) Aligned. Score:  14
Sequences (9:48) Aligned. Score:  12
Sequences (9:49) Aligned. Score:  12
Sequences (9:50) Aligned. Score:  12
Sequences (10:11) Aligned. Score:  27
Sequences (10:12) Aligned. Score:  26
Sequences (10:13) Aligned. Score:  27
Sequences (10:14) Aligned. Score:  28
Sequences (10:15) Aligned. Score:  23
Sequences (10:16) Aligned. Score:  29
Sequences (10:17) Aligned. Score:  29
Sequences (10:18) Aligned. Score:  29
Sequences (10:19) Aligned. Score:  25
Sequences (10:20) Aligned. Score:  24
Sequences (10:21) Aligned. Score:  25
Sequences (10:22) Aligned. Score:  25
Sequences (10:23) Aligned. Score:  25
Sequences (10:24) Aligned. Score:  14
Sequences (10:25) Aligned. Score:  32
Sequences (10:26) Aligned. Score:  85
Sequences (10:27) Aligned. Score:  28
Sequences (10:28) Aligned. Score:  21
Sequences (10:29) Aligned. Score:  21
Sequences (10:30) Aligned. Score:  21
Sequences (10:31) Aligned. Score:  21
Sequences (10:32) Aligned. Score:  21
Sequences (10:33) Aligned. Score:  20
Sequences (10:34) Aligned. Score:  21
Sequences (10:35) Aligned. Score:  19
Sequences (10:36) Aligned. Score:  19
Sequences (10:37) Aligned. Score:  16
Sequences (10:38) Aligned. Score:  11
Sequences (10:39) Aligned. Score:  12
Sequences (10:40) Aligned. Score:  12
Sequences (10:41) Aligned. Score:  16
Sequences (10:42) Aligned. Score:  13
Sequences (10:43) Aligned. Score:  11
Sequences (10:44) Aligned. Score:  12
Sequences (10:45) Aligned. Score:  12
Sequences (10:46) Aligned. Score:  16
Sequences (10:47) Aligned. Score:  14
Sequences (10:48) Aligned. Score:  12
Sequences (10:49) Aligned. Score:  12
Sequences (10:50) Aligned. Score:  12
Sequences (11:12) Aligned. Score:  34
Sequences (11:13) Aligned. Score:  27
Sequences (11:14) Aligned. Score:  27
Sequences (11:15) Aligned. Score:  27
Sequences (11:16) Aligned. Score:  31
Sequences (11:17) Aligned. Score:  31
Sequences (11:18) Aligned. Score:  31
Sequences (11:19) Aligned. Score:  39
Sequences (11:20) Aligned. Score:  37
Sequences (11:21) Aligned. Score:  29
Sequences (11:22) Aligned. Score:  25
Sequences (11:23) Aligned. Score:  25
Sequences (11:24) Aligned. Score:  20
Sequences (11:25) Aligned. Score:  34
Sequences (11:26) Aligned. Score:  28
Sequences (11:27) Aligned. Score:  30
Sequences (11:28) Aligned. Score:  31
Sequences (11:29) Aligned. Score:  31
Sequences (11:30) Aligned. Score:  31
Sequences (11:31) Aligned. Score:  31
Sequences (11:32) Aligned. Score:  31
Sequences (11:33) Aligned. Score:  26
Sequences (11:34) Aligned. Score:  31
Sequences (11:35) Aligned. Score:  30
Sequences (11:36) Aligned. Score:  30
Sequences (11:37) Aligned. Score:  11
Sequences (11:38) Aligned. Score:  11
Sequences (11:39) Aligned. Score:  12
Sequences (11:40) Aligned. Score:  19
Sequences (11:41) Aligned. Score:  19
Sequences (11:42) Aligned. Score:  17
Sequences (11:43) Aligned. Score:  17
Sequences (11:44) Aligned. Score:  18
Sequences (11:45) Aligned. Score:  18
Sequences (11:46) Aligned. Score:  17
Sequences (11:47) Aligned. Score:  14
Sequences (11:48) Aligned. Score:  18
Sequences (11:49) Aligned. Score:  18
Sequences (11:50) Aligned. Score:  18
Sequences (12:13) Aligned. Score:  35
Sequences (12:14) Aligned. Score:  34
Sequences (12:15) Aligned. Score:  33
Sequences (12:16) Aligned. Score:  35
Sequences (12:17) Aligned. Score:  35
Sequences (12:18) Aligned. Score:  35
Sequences (12:19) Aligned. Score:  29
Sequences (12:20) Aligned. Score:  30
Sequences (12:21) Aligned. Score:  29
Sequences (12:22) Aligned. Score:  28
Sequences (12:23) Aligned. Score:  28
Sequences (12:24) Aligned. Score:  15
Sequences (12:25) Aligned. Score:  40
Sequences (12:26) Aligned. Score:  27
Sequences (12:27) Aligned. Score:  35
Sequences (12:28) Aligned. Score:  22
Sequences (12:29) Aligned. Score:  22
Sequences (12:30) Aligned. Score:  22
Sequences (12:31) Aligned. Score:  22
Sequences (12:32) Aligned. Score:  22
Sequences (12:33) Aligned. Score:  21
Sequences (12:34) Aligned. Score:  22
Sequences (12:35) Aligned. Score:  23
Sequences (12:36) Aligned. Score:  23
Sequences (12:37) Aligned. Score:  11
Sequences (12:38) Aligned. Score:  11
Sequences (12:39) Aligned. Score:  10
Sequences (12:40) Aligned. Score:  16
Sequences (12:41) Aligned. Score:  15
Sequences (12:42) Aligned. Score:  17
Sequences (12:43) Aligned. Score:  14
Sequences (12:44) Aligned. Score:  13
Sequences (12:45) Aligned. Score:  13
Sequences (12:46) Aligned. Score:  14
Sequences (12:47) Aligned. Score:  14
Sequences (12:48) Aligned. Score:  13
Sequences (12:49) Aligned. Score:  13
Sequences (12:50) Aligned. Score:  13
Sequences (13:14) Aligned. Score:  76
Sequences (13:15) Aligned. Score:  56
Sequences (13:16) Aligned. Score:  55
Sequences (13:17) Aligned. Score:  55
Sequences (13:18) Aligned. Score:  55
Sequences (13:19) Aligned. Score:  26
Sequences (13:20) Aligned. Score:  27
Sequences (13:21) Aligned. Score:  45
Sequences (13:22) Aligned. Score:  26
Sequences (13:23) Aligned. Score:  25
Sequences (13:24) Aligned. Score:  12
Sequences (13:25) Aligned. Score:  39
Sequences (13:26) Aligned. Score:  26
Sequences (13:27) Aligned. Score:  55
Sequences (13:28) Aligned. Score:  23
Sequences (13:29) Aligned. Score:  23
Sequences (13:30) Aligned. Score:  23
Sequences (13:31) Aligned. Score:  23
Sequences (13:32) Aligned. Score:  23
Sequences (13:33) Aligned. Score:  21
Sequences (13:34) Aligned. Score:  23
Sequences (13:35) Aligned. Score:  23
Sequences (13:36) Aligned. Score:  23
Sequences (13:37) Aligned. Score:  9
Sequences (13:38) Aligned. Score:  6
Sequences (13:39) Aligned. Score:  11
Sequences (13:40) Aligned. Score:  15
Sequences (13:41) Aligned. Score:  18
Sequences (13:42) Aligned. Score:  11
Sequences (13:43) Aligned. Score:  14
Sequences (13:44) Aligned. Score:  10
Sequences (13:45) Aligned. Score:  10
Sequences (13:46) Aligned. Score:  10
Sequences (13:47) Aligned. Score:  10
Sequences (13:48) Aligned. Score:  10
Sequences (13:49) Aligned. Score:  10
Sequences (13:50) Aligned. Score:  10
Sequences (14:15) Aligned. Score:  57
Sequences (14:16) Aligned. Score:  57
Sequences (14:17) Aligned. Score:  57
Sequences (14:18) Aligned. Score:  57
Sequences (14:19) Aligned. Score:  25
Sequences (14:20) Aligned. Score:  25
Sequences (14:21) Aligned. Score:  45
Sequences (14:22) Aligned. Score:  25
Sequences (14:23) Aligned. Score:  25
Sequences (14:24) Aligned. Score:  15
Sequences (14:25) Aligned. Score:  38
Sequences (14:26) Aligned. Score:  29
Sequences (14:27) Aligned. Score:  57
Sequences (14:28) Aligned. Score:  22
Sequences (14:29) Aligned. Score:  22
Sequences (14:30) Aligned. Score:  22
Sequences (14:31) Aligned. Score:  22
Sequences (14:32) Aligned. Score:  22
Sequences (14:33) Aligned. Score:  19
Sequences (14:34) Aligned. Score:  22
Sequences (14:35) Aligned. Score:  22
Sequences (14:36) Aligned. Score:  22
Sequences (14:37) Aligned. Score:  11
Sequences (14:38) Aligned. Score:  10
Sequences (14:39) Aligned. Score:  13
Sequences (14:40) Aligned. Score:  17
Sequences (14:41) Aligned. Score:  17
Sequences (14:42) Aligned. Score:  11
Sequences (14:43) Aligned. Score:  16
Sequences (14:44) Aligned. Score:  9
Sequences (14:45) Aligned. Score:  9
Sequences (14:46) Aligned. Score:  9
Sequences (14:47) Aligned. Score:  9
Sequences (14:48) Aligned. Score:  9
Sequences (14:49) Aligned. Score:  9
Sequences (14:50) Aligned. Score:  9
Sequences (15:16) Aligned. Score:  53
Sequences (15:17) Aligned. Score:  53
Sequences (15:18) Aligned. Score:  53
Sequences (15:19) Aligned. Score:  28
Sequences (15:20) Aligned. Score:  29
Sequences (15:21) Aligned. Score:  38
Sequences (15:22) Aligned. Score:  24
Sequences (15:23) Aligned. Score:  23
Sequences (15:24) Aligned. Score:  16
Sequences (15:25) Aligned. Score:  38
Sequences (15:26) Aligned. Score:  25
Sequences (15:27) Aligned. Score:  53
Sequences (15:28) Aligned. Score:  23
Sequences (15:29) Aligned. Score:  23
Sequences (15:30) Aligned. Score:  23
Sequences (15:31) Aligned. Score:  23
Sequences (15:32) Aligned. Score:  23
Sequences (15:33) Aligned. Score:  21
Sequences (15:34) Aligned. Score:  23
Sequences (15:35) Aligned. Score:  25
Sequences (15:36) Aligned. Score:  23
Sequences (15:37) Aligned. Score:  6
Sequences (15:38) Aligned. Score:  7
Sequences (15:39) Aligned. Score:  12
Sequences (15:40) Aligned. Score:  19
Sequences (15:41) Aligned. Score:  18
Sequences (15:42) Aligned. Score:  18
Sequences (15:43) Aligned. Score:  20
Sequences (15:44) Aligned. Score:  15
Sequences (15:45) Aligned. Score:  15
Sequences (15:46) Aligned. Score:  15
Sequences (15:47) Aligned. Score:  16
Sequences (15:48) Aligned. Score:  15
Sequences (15:49) Aligned. Score:  15
Sequences (15:50) Aligned. Score:  15
Sequences (16:17) Aligned. Score:  100
Sequences (16:18) Aligned. Score:  100
Sequences (16:19) Aligned. Score:  29
Sequences (16:20) Aligned. Score:  30
Sequences (16:21) Aligned. Score:  53
Sequences (16:22) Aligned. Score:  23
Sequences (16:23) Aligned. Score:  22
Sequences (16:24) Aligned. Score:  15
Sequences (16:25) Aligned. Score:  48
Sequences (16:26) Aligned. Score:  30
Sequences (16:27) Aligned. Score:  100
Sequences (16:28) Aligned. Score:  21
Sequences (16:29) Aligned. Score:  21
Sequences (16:30) Aligned. Score:  21
Sequences (16:31) Aligned. Score:  21
Sequences (16:32) Aligned. Score:  21
Sequences (16:33) Aligned. Score:  18
Sequences (16:34) Aligned. Score:  21
Sequences (16:35) Aligned. Score:  21
Sequences (16:36) Aligned. Score:  21
Sequences (16:37) Aligned. Score:  15
Sequences (16:38) Aligned. Score:  11
Sequences (16:39) Aligned. Score:  15
Sequences (16:40) Aligned. Score:  19
Sequences (16:41) Aligned. Score:  16
Sequences (16:42) Aligned. Score:  19
Sequences (16:43) Aligned. Score:  17
Sequences (16:44) Aligned. Score:  17
Sequences (16:45) Aligned. Score:  17
Sequences (16:46) Aligned. Score:  17
Sequences (16:47) Aligned. Score:  14
Sequences (16:48) Aligned. Score:  17
Sequences (16:49) Aligned. Score:  17
Sequences (16:50) Aligned. Score:  17
Sequences (17:18) Aligned. Score:  100
Sequences (17:19) Aligned. Score:  29
Sequences (17:20) Aligned. Score:  30
Sequences (17:21) Aligned. Score:  53
Sequences (17:22) Aligned. Score:  23
Sequences (17:23) Aligned. Score:  22
Sequences (17:24) Aligned. Score:  15
Sequences (17:25) Aligned. Score:  48
Sequences (17:26) Aligned. Score:  30
Sequences (17:27) Aligned. Score:  100
Sequences (17:28) Aligned. Score:  21
Sequences (17:29) Aligned. Score:  21
Sequences (17:30) Aligned. Score:  21
Sequences (17:31) Aligned. Score:  21
Sequences (17:32) Aligned. Score:  21
Sequences (17:33) Aligned. Score:  18
Sequences (17:34) Aligned. Score:  21
Sequences (17:35) Aligned. Score:  21
Sequences (17:36) Aligned. Score:  21
Sequences (17:37) Aligned. Score:  15
Sequences (17:38) Aligned. Score:  11
Sequences (17:39) Aligned. Score:  15
Sequences (17:40) Aligned. Score:  19
Sequences (17:41) Aligned. Score:  16
Sequences (17:42) Aligned. Score:  19
Sequences (17:43) Aligned. Score:  17
Sequences (17:44) Aligned. Score:  17
Sequences (17:45) Aligned. Score:  17
Sequences (17:46) Aligned. Score:  17
Sequences (17:47) Aligned. Score:  14
Sequences (17:48) Aligned. Score:  17
Sequences (17:49) Aligned. Score:  17
Sequences (17:50) Aligned. Score:  17
Sequences (18:19) Aligned. Score:  29
Sequences (18:20) Aligned. Score:  30
Sequences (18:21) Aligned. Score:  53
Sequences (18:22) Aligned. Score:  23
Sequences (18:23) Aligned. Score:  22
Sequences (18:24) Aligned. Score:  15
Sequences (18:25) Aligned. Score:  48
Sequences (18:26) Aligned. Score:  30
Sequences (18:27) Aligned. Score:  100
Sequences (18:28) Aligned. Score:  21
Sequences (18:29) Aligned. Score:  21
Sequences (18:30) Aligned. Score:  21
Sequences (18:31) Aligned. Score:  21
Sequences (18:32) Aligned. Score:  21
Sequences (18:33) Aligned. Score:  18
Sequences (18:34) Aligned. Score:  21
Sequences (18:35) Aligned. Score:  21
Sequences (18:36) Aligned. Score:  21
Sequences (18:37) Aligned. Score:  15
Sequences (18:38) Aligned. Score:  11
Sequences (18:39) Aligned. Score:  15
Sequences (18:40) Aligned. Score:  19
Sequences (18:41) Aligned. Score:  16
Sequences (18:42) Aligned. Score:  19
Sequences (18:43) Aligned. Score:  17
Sequences (18:44) Aligned. Score:  17
Sequences (18:45) Aligned. Score:  17
Sequences (18:46) Aligned. Score:  17
Sequences (18:47) Aligned. Score:  14
Sequences (18:48) Aligned. Score:  17
Sequences (18:49) Aligned. Score:  17
Sequences (18:50) Aligned. Score:  17
Sequences (19:20) Aligned. Score:  79
Sequences (19:21) Aligned. Score:  27
Sequences (19:22) Aligned. Score:  25
Sequences (19:23) Aligned. Score:  25
Sequences (19:24) Aligned. Score:  14
Sequences (19:25) Aligned. Score:  30
Sequences (19:26) Aligned. Score:  25
Sequences (19:27) Aligned. Score:  27
Sequences (19:28) Aligned. Score:  27
Sequences (19:29) Aligned. Score:  27
Sequences (19:30) Aligned. Score:  27
Sequences (19:31) Aligned. Score:  25
Sequences (19:32) Aligned. Score:  27
Sequences (19:33) Aligned. Score:  23
Sequences (19:34) Aligned. Score:  27
Sequences (19:35) Aligned. Score:  27
Sequences (19:36) Aligned. Score:  27
Sequences (19:37) Aligned. Score:  15
Sequences (19:38) Aligned. Score:  15
Sequences (19:39) Aligned. Score:  13
Sequences (19:40) Aligned. Score:  18
Sequences (19:41) Aligned. Score:  18
Sequences (19:42) Aligned. Score:  15
Sequences (19:43) Aligned. Score:  18
Sequences (19:44) Aligned. Score:  15
Sequences (19:45) Aligned. Score:  15
Sequences (19:46) Aligned. Score:  16
Sequences (19:47) Aligned. Score:  15
Sequences (19:48) Aligned. Score:  15
Sequences (19:49) Aligned. Score:  15
Sequences (19:50) Aligned. Score:  15
Sequences (20:21) Aligned. Score:  27
Sequences (20:22) Aligned. Score:  25
Sequences (20:23) Aligned. Score:  26
Sequences (20:24) Aligned. Score:  15
Sequences (20:25) Aligned. Score:  30
Sequences (20:26) Aligned. Score:  25
Sequences (20:27) Aligned. Score:  29
Sequences (20:28) Aligned. Score:  28
Sequences (20:29) Aligned. Score:  28
Sequences (20:30) Aligned. Score:  28
Sequences (20:31) Aligned. Score:  28
Sequences (20:32) Aligned. Score:  28
Sequences (20:33) Aligned. Score:  24
Sequences (20:34) Aligned. Score:  28
Sequences (20:35) Aligned. Score:  29
Sequences (20:36) Aligned. Score:  28
Sequences (20:37) Aligned. Score:  12
Sequences (20:38) Aligned. Score:  14
Sequences (20:39) Aligned. Score:  14
Sequences (20:40) Aligned. Score:  18
Sequences (20:41) Aligned. Score:  18
Sequences (20:42) Aligned. Score:  18
Sequences (20:43) Aligned. Score:  19
Sequences (20:44) Aligned. Score:  17
Sequences (20:45) Aligned. Score:  17
Sequences (20:46) Aligned. Score:  17
Sequences (20:47) Aligned. Score:  16
Sequences (20:48) Aligned. Score:  17
Sequences (20:49) Aligned. Score:  17
Sequences (20:50) Aligned. Score:  17
Sequences (21:22) Aligned. Score:  24
Sequences (21:23) Aligned. Score:  24
Sequences (21:24) Aligned. Score:  19
Sequences (21:25) Aligned. Score:  41
Sequences (21:26) Aligned. Score:  25
Sequences (21:27) Aligned. Score:  52
Sequences (21:28) Aligned. Score:  26
Sequences (21:29) Aligned. Score:  26
Sequences (21:30) Aligned. Score:  26
Sequences (21:31) Aligned. Score:  26
Sequences (21:32) Aligned. Score:  24
Sequences (21:33) Aligned. Score:  23
Sequences (21:34) Aligned. Score:  24
Sequences (21:35) Aligned. Score:  25
Sequences (21:36) Aligned. Score:  25
Sequences (21:37) Aligned. Score:  8
Sequences (21:38) Aligned. Score:  8
Sequences (21:39) Aligned. Score:  13
Sequences (21:40) Aligned. Score:  17
Sequences (21:41) Aligned. Score:  18
Sequences (21:42) Aligned. Score:  14
Sequences (21:43) Aligned. Score:  13
Sequences (21:44) Aligned. Score:  10
Sequences (21:45) Aligned. Score:  10
Sequences (21:46) Aligned. Score:  15
Sequences (21:47) Aligned. Score:  16
Sequences (21:48) Aligned. Score:  10
Sequences (21:49) Aligned. Score:  10
Sequences (21:50) Aligned. Score:  10
Sequences (22:23) Aligned. Score:  95
Sequences (22:24) Aligned. Score:  16
Sequences (22:25) Aligned. Score:  26
Sequences (22:26) Aligned. Score:  25
Sequences (22:27) Aligned. Score:  22
Sequences (22:28) Aligned. Score:  19
Sequences (22:29) Aligned. Score:  19
Sequences (22:30) Aligned. Score:  19
Sequences (22:31) Aligned. Score:  20
Sequences (22:32) Aligned. Score:  19
Sequences (22:33) Aligned. Score:  17
Sequences (22:34) Aligned. Score:  19
Sequences (22:35) Aligned. Score:  20
Sequences (22:36) Aligned. Score:  20
Sequences (22:37) Aligned. Score:  13
Sequences (22:38) Aligned. Score:  9
Sequences (22:39) Aligned. Score:  10
Sequences (22:40) Aligned. Score:  14
Sequences (22:41) Aligned. Score:  15
Sequences (22:42) Aligned. Score:  19
Sequences (22:43) Aligned. Score:  15
Sequences (22:44) Aligned. Score:  11
Sequences (22:45) Aligned. Score:  11
Sequences (22:46) Aligned. Score:  10
Sequences (22:47) Aligned. Score:  10
Sequences (22:48) Aligned. Score:  11
Sequences (22:49) Aligned. Score:  11
Sequences (22:50) Aligned. Score:  11
Sequences (23:24) Aligned. Score:  17
Sequences (23:25) Aligned. Score:  26
Sequences (23:26) Aligned. Score:  24
Sequences (23:27) Aligned. Score:  21
Sequences (23:28) Aligned. Score:  19
Sequences (23:29) Aligned. Score:  19
Sequences (23:30) Aligned. Score:  19
Sequences (23:31) Aligned. Score:  20
Sequences (23:32) Aligned. Score:  19
Sequences (23:33) Aligned. Score:  17
Sequences (23:34) Aligned. Score:  19
Sequences (23:35) Aligned. Score:  17
Sequences (23:36) Aligned. Score:  17
Sequences (23:37) Aligned. Score:  12
Sequences (23:38) Aligned. Score:  11
Sequences (23:39) Aligned. Score:  13
Sequences (23:40) Aligned. Score:  15
Sequences (23:41) Aligned. Score:  15
Sequences (23:42) Aligned. Score:  19
Sequences (23:43) Aligned. Score:  16
Sequences (23:44) Aligned. Score:  12
Sequences (23:45) Aligned. Score:  12
Sequences (23:46) Aligned. Score:  10
Sequences (23:47) Aligned. Score:  10
Sequences (23:48) Aligned. Score:  12
Sequences (23:49) Aligned. Score:  12
Sequences (23:50) Aligned. Score:  12
Sequences (24:25) Aligned. Score:  20
Sequences (24:26) Aligned. Score:  15
Sequences (24:27) Aligned. Score:  18
Sequences (24:28) Aligned. Score:  16
Sequences (24:29) Aligned. Score:  16
Sequences (24:30) Aligned. Score:  16
Sequences (24:31) Aligned. Score:  15
Sequences (24:32) Aligned. Score:  16
Sequences (24:33) Aligned. Score:  16
Sequences (24:34) Aligned. Score:  16
Sequences (24:35) Aligned. Score:  12
Sequences (24:36) Aligned. Score:  12
Sequences (24:37) Aligned. Score:  12
Sequences (24:38) Aligned. Score:  11
Sequences (24:39) Aligned. Score:  13
Sequences (24:40) Aligned. Score:  11
Sequences (24:41) Aligned. Score:  10
Sequences (24:42) Aligned. Score:  11
Sequences (24:43) Aligned. Score:  11
Sequences (24:44) Aligned. Score:  7
Sequences (24:45) Aligned. Score:  7
Sequences (24:46) Aligned. Score:  9
Sequences (24:47) Aligned. Score:  9
Sequences (24:48) Aligned. Score:  7
Sequences (24:49) Aligned. Score:  7
Sequences (24:50) Aligned. Score:  7
Sequences (25:26) Aligned. Score:  32
Sequences (25:27) Aligned. Score:  48
Sequences (25:28) Aligned. Score:  23
Sequences (25:29) Aligned. Score:  23
Sequences (25:30) Aligned. Score:  23
Sequences (25:31) Aligned. Score:  23
Sequences (25:32) Aligned. Score:  23
Sequences (25:33) Aligned. Score:  20
Sequences (25:34) Aligned. Score:  23
Sequences (25:35) Aligned. Score:  22
Sequences (25:36) Aligned. Score:  22
Sequences (25:37) Aligned. Score:  13
Sequences (25:38) Aligned. Score:  10
Sequences (25:39) Aligned. Score:  11
Sequences (25:40) Aligned. Score:  21
Sequences (25:41) Aligned. Score:  21
Sequences (25:42) Aligned. Score:  21
Sequences (25:43) Aligned. Score:  21
Sequences (25:44) Aligned. Score:  17
Sequences (25:45) Aligned. Score:  17
Sequences (25:46) Aligned. Score:  16
Sequences (25:47) Aligned. Score:  11
Sequences (25:48) Aligned. Score:  17
Sequences (25:49) Aligned. Score:  17
Sequences (25:50) Aligned. Score:  17
Sequences (26:27) Aligned. Score:  29
Sequences (26:28) Aligned. Score:  23
Sequences (26:29) Aligned. Score:  23
Sequences (26:30) Aligned. Score:  23
Sequences (26:31) Aligned. Score:  23
Sequences (26:32) Aligned. Score:  23
Sequences (26:33) Aligned. Score:  21
Sequences (26:34) Aligned. Score:  23
Sequences (26:35) Aligned. Score:  21
Sequences (26:36) Aligned. Score:  21
Sequences (26:37) Aligned. Score:  15
Sequences (26:38) Aligned. Score:  16
Sequences (26:39) Aligned. Score:  14
Sequences (26:40) Aligned. Score:  20
Sequences (26:41) Aligned. Score:  14
Sequences (26:42) Aligned. Score:  17
Sequences (26:43) Aligned. Score:  13
Sequences (26:44) Aligned. Score:  16
Sequences (26:45) Aligned. Score:  16
Sequences (26:46) Aligned. Score:  16
Sequences (26:47) Aligned. Score:  17
Sequences (26:48) Aligned. Score:  16
Sequences (26:49) Aligned. Score:  16
Sequences (26:50) Aligned. Score:  16
Sequences (27:28) Aligned. Score:  22
Sequences (27:29) Aligned. Score:  22
Sequences (27:30) Aligned. Score:  22
Sequences (27:31) Aligned. Score:  22
Sequences (27:32) Aligned. Score:  22
Sequences (27:33) Aligned. Score:  20
Sequences (27:34) Aligned. Score:  22
Sequences (27:35) Aligned. Score:  20
Sequences (27:36) Aligned. Score:  20
Sequences (27:37) Aligned. Score:  15
Sequences (27:38) Aligned. Score:  11
Sequences (27:39) Aligned. Score:  14
Sequences (27:40) Aligned. Score:  19
Sequences (27:41) Aligned. Score:  16
Sequences (27:42) Aligned. Score:  19
Sequences (27:43) Aligned. Score:  17
Sequences (27:44) Aligned. Score:  17
Sequences (27:45) Aligned. Score:  17
Sequences (27:46) Aligned. Score:  17
Sequences (27:47) Aligned. Score:  14
Sequences (27:48) Aligned. Score:  17
Sequences (27:49) Aligned. Score:  17
Sequences (27:50) Aligned. Score:  17
Sequences (28:29) Aligned. Score:  100
Sequences (28:30) Aligned. Score:  100
Sequences (28:31) Aligned. Score:  99
Sequences (28:32) Aligned. Score:  99
Sequences (28:33) Aligned. Score:  90
Sequences (28:34) Aligned. Score:  99
Sequences (28:35) Aligned. Score:  87
Sequences (28:36) Aligned. Score:  87
Sequences (28:37) Aligned. Score:  9
Sequences (28:38) Aligned. Score:  6
Sequences (28:39) Aligned. Score:  8
Sequences (28:40) Aligned. Score:  18
Sequences (28:41) Aligned. Score:  16
Sequences (28:42) Aligned. Score:  21
Sequences (28:43) Aligned. Score:  17
Sequences (28:44) Aligned. Score:  17
Sequences (28:45) Aligned. Score:  17
Sequences (28:46) Aligned. Score:  14
Sequences (28:47) Aligned. Score:  14
Sequences (28:48) Aligned. Score:  17
Sequences (28:49) Aligned. Score:  17
Sequences (28:50) Aligned. Score:  17
Sequences (29:30) Aligned. Score:  100
Sequences (29:31) Aligned. Score:  99
Sequences (29:32) Aligned. Score:  99
Sequences (29:33) Aligned. Score:  90
Sequences (29:34) Aligned. Score:  99
Sequences (29:35) Aligned. Score:  87
Sequences (29:36) Aligned. Score:  87
Sequences (29:37) Aligned. Score:  9
Sequences (29:38) Aligned. Score:  6
Sequences (29:39) Aligned. Score:  8
Sequences (29:40) Aligned. Score:  18
Sequences (29:41) Aligned. Score:  16
Sequences (29:42) Aligned. Score:  21
Sequences (29:43) Aligned. Score:  17
Sequences (29:44) Aligned. Score:  17
Sequences (29:45) Aligned. Score:  17
Sequences (29:46) Aligned. Score:  14
Sequences (29:47) Aligned. Score:  14
Sequences (29:48) Aligned. Score:  17
Sequences (29:49) Aligned. Score:  17
Sequences (29:50) Aligned. Score:  17
Sequences (30:31) Aligned. Score:  99
Sequences (30:32) Aligned. Score:  99
Sequences (30:33) Aligned. Score:  90
Sequences (30:34) Aligned. Score:  99
Sequences (30:35) Aligned. Score:  87
Sequences (30:36) Aligned. Score:  87
Sequences (30:37) Aligned. Score:  9
Sequences (30:38) Aligned. Score:  6
Sequences (30:39) Aligned. Score:  8
Sequences (30:40) Aligned. Score:  18
Sequences (30:41) Aligned. Score:  16
Sequences (30:42) Aligned. Score:  21
Sequences (30:43) Aligned. Score:  17
Sequences (30:44) Aligned. Score:  17
Sequences (30:45) Aligned. Score:  17
Sequences (30:46) Aligned. Score:  14
Sequences (30:47) Aligned. Score:  14
Sequences (30:48) Aligned. Score:  17
Sequences (30:49) Aligned. Score:  17
Sequences (30:50) Aligned. Score:  17
Sequences (31:32) Aligned. Score:  99
Sequences (31:33) Aligned. Score:  90
Sequences (31:34) Aligned. Score:  99
Sequences (31:35) Aligned. Score:  87
Sequences (31:36) Aligned. Score:  87
Sequences (31:37) Aligned. Score:  9
Sequences (31:38) Aligned. Score:  6
Sequences (31:39) Aligned. Score:  8
Sequences (31:40) Aligned. Score:  18
Sequences (31:41) Aligned. Score:  16
Sequences (31:42) Aligned. Score:  21
Sequences (31:43) Aligned. Score:  17
Sequences (31:44) Aligned. Score:  17
Sequences (31:45) Aligned. Score:  17
Sequences (31:46) Aligned. Score:  14
Sequences (31:47) Aligned. Score:  14
Sequences (31:48) Aligned. Score:  17
Sequences (31:49) Aligned. Score:  17
Sequences (31:50) Aligned. Score:  17
Sequences (32:33) Aligned. Score:  90
Sequences (32:34) Aligned. Score:  100
Sequences (32:35) Aligned. Score:  87
Sequences (32:36) Aligned. Score:  87
Sequences (32:37) Aligned. Score:  9
Sequences (32:38) Aligned. Score:  6
Sequences (32:39) Aligned. Score:  8
Sequences (32:40) Aligned. Score:  18
Sequences (32:41) Aligned. Score:  16
Sequences (32:42) Aligned. Score:  21
Sequences (32:43) Aligned. Score:  17
Sequences (32:44) Aligned. Score:  17
Sequences (32:45) Aligned. Score:  17
Sequences (32:46) Aligned. Score:  14
Sequences (32:47) Aligned. Score:  15
Sequences (32:48) Aligned. Score:  17
Sequences (32:49) Aligned. Score:  17
Sequences (32:50) Aligned. Score:  17
Sequences (33:34) Aligned. Score:  90
Sequences (33:35) Aligned. Score:  79
Sequences (33:36) Aligned. Score:  79
Sequences (33:37) Aligned. Score:  6
Sequences (33:38) Aligned. Score:  11
Sequences (33:39) Aligned. Score:  4
Sequences (33:40) Aligned. Score:  16
Sequences (33:41) Aligned. Score:  16
Sequences (33:42) Aligned. Score:  18
Sequences (33:43) Aligned. Score:  14
Sequences (33:44) Aligned. Score:  14
Sequences (33:45) Aligned. Score:  14
Sequences (33:46) Aligned. Score:  13
Sequences (33:47) Aligned. Score:  11
Sequences (33:48) Aligned. Score:  14
Sequences (33:49) Aligned. Score:  14
Sequences (33:50) Aligned. Score:  14
Sequences (34:35) Aligned. Score:  87
Sequences (34:36) Aligned. Score:  87
Sequences (34:37) Aligned. Score:  9
Sequences (34:38) Aligned. Score:  6
Sequences (34:39) Aligned. Score:  8
Sequences (34:40) Aligned. Score:  18
Sequences (34:41) Aligned. Score:  16
Sequences (34:42) Aligned. Score:  21
Sequences (34:43) Aligned. Score:  17
Sequences (34:44) Aligned. Score:  17
Sequences (34:45) Aligned. Score:  17
Sequences (34:46) Aligned. Score:  14
Sequences (34:47) Aligned. Score:  15
Sequences (34:48) Aligned. Score:  17
Sequences (34:49) Aligned. Score:  17
Sequences (34:50) Aligned. Score:  17
Sequences (35:36) Aligned. Score:  99
Sequences (35:37) Aligned. Score:  9
Sequences (35:38) Aligned. Score:  8
Sequences (35:39) Aligned. Score:  7
Sequences (35:40) Aligned. Score:  17
Sequences (35:41) Aligned. Score:  16
Sequences (35:42) Aligned. Score:  21
Sequences (35:43) Aligned. Score:  17
Sequences (35:44) Aligned. Score:  17
Sequences (35:45) Aligned. Score:  17
Sequences (35:46) Aligned. Score:  11
Sequences (35:47) Aligned. Score:  15
Sequences (35:48) Aligned. Score:  17
Sequences (35:49) Aligned. Score:  17
Sequences (35:50) Aligned. Score:  17
Sequences (36:37) Aligned. Score:  9
Sequences (36:38) Aligned. Score:  8
Sequences (36:39) Aligned. Score:  9
Sequences (36:40) Aligned. Score:  17
Sequences (36:41) Aligned. Score:  16
Sequences (36:42) Aligned. Score:  20
Sequences (36:43) Aligned. Score:  17
Sequences (36:44) Aligned. Score:  17
Sequences (36:45) Aligned. Score:  17
Sequences (36:46) Aligned. Score:  11
Sequences (36:47) Aligned. Score:  15
Sequences (36:48) Aligned. Score:  17
Sequences (36:49) Aligned. Score:  17
Sequences (36:50) Aligned. Score:  17
Sequences (37:38) Aligned. Score:  82
Sequences (37:39) Aligned. Score:  65
Sequences (37:40) Aligned. Score:  21
Sequences (37:41) Aligned. Score:  21
Sequences (37:42) Aligned. Score:  20
Sequences (37:43) Aligned. Score:  21
Sequences (37:44) Aligned. Score:  22
Sequences (37:45) Aligned. Score:  22
Sequences (37:46) Aligned. Score:  19
Sequences (37:47) Aligned. Score:  17
Sequences (37:48) Aligned. Score:  22
Sequences (37:49) Aligned. Score:  22
Sequences (37:50) Aligned. Score:  22
Sequences (38:39) Aligned. Score:  63
Sequences (38:40) Aligned. Score:  21
Sequences (38:41) Aligned. Score:  22
Sequences (38:42) Aligned. Score:  21
Sequences (38:43) Aligned. Score:  22
Sequences (38:44) Aligned. Score:  22
Sequences (38:45) Aligned. Score:  22
Sequences (38:46) Aligned. Score:  21
Sequences (38:47) Aligned. Score:  17
Sequences (38:48) Aligned. Score:  22
Sequences (38:49) Aligned. Score:  22
Sequences (38:50) Aligned. Score:  22
Sequences (39:40) Aligned. Score:  20
Sequences (39:41) Aligned. Score:  22
Sequences (39:42) Aligned. Score:  18
Sequences (39:43) Aligned. Score:  20
Sequences (39:44) Aligned. Score:  22
Sequences (39:45) Aligned. Score:  22
Sequences (39:46) Aligned. Score:  22
Sequences (39:47) Aligned. Score:  22
Sequences (39:48) Aligned. Score:  22
Sequences (39:49) Aligned. Score:  22
Sequences (39:50) Aligned. Score:  22
Sequences (40:41) Aligned. Score:  86
Sequences (40:42) Aligned. Score:  51
Sequences (40:43) Aligned. Score:  52
Sequences (40:44) Aligned. Score:  53
Sequences (40:45) Aligned. Score:  53
Sequences (40:46) Aligned. Score:  48
Sequences (40:47) Aligned. Score:  47
Sequences (40:48) Aligned. Score:  53
Sequences (40:49) Aligned. Score:  53
Sequences (40:50) Aligned. Score:  53
Sequences (41:42) Aligned. Score:  51
Sequences (41:43) Aligned. Score:  52
Sequences (41:44) Aligned. Score:  52
Sequences (41:45) Aligned. Score:  52
Sequences (41:46) Aligned. Score:  47
Sequences (41:47) Aligned. Score:  47
Sequences (41:48) Aligned. Score:  52
Sequences (41:49) Aligned. Score:  52
Sequences (41:50) Aligned. Score:  52
Sequences (42:43) Aligned. Score:  56
Sequences (42:44) Aligned. Score:  52
Sequences (42:45) Aligned. Score:  52
Sequences (42:46) Aligned. Score:  49
Sequences (42:47) Aligned. Score:  49
Sequences (42:48) Aligned. Score:  52
Sequences (42:49) Aligned. Score:  52
Sequences (42:50) Aligned. Score:  52
Sequences (43:44) Aligned. Score:  57
Sequences (43:45) Aligned. Score:  57
Sequences (43:46) Aligned. Score:  54
Sequences (43:47) Aligned. Score:  54
Sequences (43:48) Aligned. Score:  57
Sequences (43:49) Aligned. Score:  57
Sequences (43:50) Aligned. Score:  57
Sequences (44:45) Aligned. Score:  100
Sequences (44:46) Aligned. Score:  80
Sequences (44:47) Aligned. Score:  80
Sequences (44:48) Aligned. Score:  100
Sequences (44:49) Aligned. Score:  100
Sequences (44:50) Aligned. Score:  100
Sequences (45:46) Aligned. Score:  80
Sequences (45:47) Aligned. Score:  80
Sequences (45:48) Aligned. Score:  100
Sequences (45:49) Aligned. Score:  100
Sequences (45:50) Aligned. Score:  100
Sequences (46:47) Aligned. Score:  93
Sequences (46:48) Aligned. Score:  80
Sequences (46:49) Aligned. Score:  80
Sequences (46:50) Aligned. Score:  80
Sequences (47:48) Aligned. Score:  80
Sequences (47:49) Aligned. Score:  80
Sequences (47:50) Aligned. Score:  80
Sequences (48:49) Aligned. Score:  100
Sequences (48:50) Aligned. Score:  100
Sequences (49:50) Aligned. Score:  100
Guide tree        file created:   [clustalw.dnd]
Start of Multiple Alignment
There are 49 groups
Aligning...
Group 1: Sequences:   2      Score:6620
Group 2: Sequences:   3      Score:3487
Group 3: Sequences:   2      Score:6860
Group 4: Sequences:   3      Score:6860
Group 5: Sequences:   4      Score:6860
Group 6: Sequences:   7      Score:3431
Group 7: Sequences:   8      Score:3259
Group 8: Sequences:   9      Score:3056
Group 9: Sequences:  10      Score:2818
Group 10: Sequences:   2      Score:7051
Group 11: Sequences:   3      Score:3178
Group 12: Sequences:   2      Score:7685
Group 13: Sequences:   3      Score:7685
Group 14: Sequences:   2      Score:7683
Group 15: Sequences:   5      Score:7677
Group 16: Sequences:   6      Score:7580
Group 17: Sequences:   7      Score:7060
Group 18: Sequences:   2      Score:7566
Group 19: Sequences:   9      Score:6796
Group 20: Sequences:  12      Score:2748
Group 21: Sequences:  22      Score:2187
Group 22: Sequences:   2      Score:7195
Group 23: Sequences:   3      Score:6671
Group 24: Sequences:  25      Score:2441
Group 25: Sequences:   2      Score:7823
Group 26: Sequences:  27      Score:2413
Group 27:                     Delayed
Group 28: Sequences:   2      Score:4815
Group 29: Sequences:   2      Score:9382
Group 30: Sequences:   3      Score:5066
Group 31: Sequences:   5      Score:4665
Group 32: Sequences:   2      Score:9416
Group 33: Sequences:   7      Score:4488
Group 34: Sequences:   2      Score:9098
Group 35: Sequences:   3      Score:8428
Group 36: Sequences:  10      Score:3954
Group 37: Sequences:   2      Score:5063
Group 38: Sequences:   2      Score:5642
Group 39: Sequences:   3      Score:5642
Group 40: Sequences:   4      Score:5642
Group 41: Sequences:   5      Score:5642
Group 42: Sequences:   2      Score:5541
Group 43: Sequences:   7      Score:5051
Group 44: Sequences:   8      Score:2757
Group 45: Sequences:   9      Score:2676
Group 46: Sequences:  11      Score:2677
Group 47: Sequences:  21      Score:1501
Group 48: Sequences:  48      Score:1956
Group 49:                     Delayed
Sequence:24     Score:2816
Sequence:1     Score:2603
Alignment Score 243881
CLUSTAL-Alignment file created  [clustalw.aln]

clustalw.aln
CLUSTAL W (1.83) multiple sequence alignment sw|P57309|FTSA_BUCAI_Cell_divi ---------------MIISKDRKLVVGLEIGTTKVVTLVGEVLIDD---- sw|O51928|FTSA_BUCAP_Cell_divi ---------------MIISKNRKLVVGLEIGTTKVVTLVGEVLTNG---- sw|Q89AQ4|FTSA_BUCBP_Cell_divi ---------------MIKVLKKKLIVGLEIGTTKTTISVGEILEDD---- sw|P0ABH2|FTSA_ECO57_Cell_divi ---------------MIKATDRKLVVGLEIGTAKVAALVGEVLPDG---- sw|P0ABH3|FTSA_SHIFL_Cell_divi ---------------MIKATDRKLVVGLEIGTAKVAALVGEVLPDG---- sw|P0ABH1|FTSA_ECOL6_Cell_divi ---------------MIKATDRKLVVGLEIGTAKVAALVGEVLPDG---- sw|P0ABH0|FTSA_ECOLI_Cell_divi ---------------MIKATDRKLVVGLEIGTAKVAALVGEVLPDG---- sw|P45068|FTSA_HAEIN_Cell_divi ---------------MVKGVETKTIVGLEVGTSKVVVVVGEVFPDG---- sw|P47203|FTSA_PSEAE_Cell_divi ---------------MASVQSGKMIVGLDIGTSKVVALVGEVTADG---- sw|Q44774|FTSA_BORBU_Cell_divi -------------------MSRNLIVGLDVGTSKICTVVAEVNLND---- sw|O07111|FTSA_ENTFA_Cell_divi ------------------MAKTGMYVGLDIGTTSVKVVVAEYIEG----- sw|O07672|FTSA_ENTHR_Cell_divi ------------------MAKTGMYVGLDIGTTSVKVVVAEYIDS----- sw|P28264|FTSA_BACSU_Cell_divi ------------------MNNNELYVSLDLGTSNTKVIVGEMTGD----- sw|Q5HGP6|FTSA_STAAC_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|P63764|FTSA_STAAM_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|P63765|FTSA_STAAN_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|Q6GA27|FTSA_STAAS_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|Q8NX33|FTSA_STAAW_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|Q6GHQ0|FTSA_STAAR_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|O07325|FTSA_STAAU_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|Q5HQ07|FTSA_STAEQ_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|Q8CPK5|FTSA_STAES_Cell_divi -------------------MEEHYYVSIDIGSSSVKTIVGEKFHN----- sw|P0A331|FTSA_AGRT5_Cell_divi MSFFGSSHFGLPRLKPLSSKRSHIVSVLDIGSTKVVCMIGRLTPRQESEI sw|P0A332|FTSA_AGRTU_Cell_divi MSFFGSSHFGLPRLKPLSSKRSHIVSVLDIGSTKVVCMIGRLTPRQESEI sw|O30994|FTSA_RHIME_Cell_divi MSLFGSANFGLPRLKPLPSKRSHVVSVLDIGSTKVVCMIGRLTPRAESQI sw|Q9ZKM3|FTSA_HELPJ_Cell_divi ------------------MEHKEIVIGVDIGSRKICAIVAEFKDG----- sw|O25629|FTSA_HELPY_Cell_divi ------------------MEHKEIVIGVDLGSRKICAIVAEFKEG----- sw|Q9HHB9|DNAK_HALME_Chaperone -------------------MASNKILGIDLGTTNSAFAVME-GGD----- sw|Q9WYK6|DNAK_THEMA_Chaperone -----------------MAEKKEFVVGIDLGTTNSVIAWMKPDGT----- sw|Q9ZAD3|DNAK_PORGI_Chaperone ---------------------MGKIIGIDLGTTNSCVSVLE-GNE----- sw|Q9XCB1|DNAK_RHOMR_Chaperone ---------------------MGKIIGIDLGTTNSVVAVME-GGE----- sw|Q8EPW4|DNAK_OCEIH_Chaperone ---------------------MSKIIGIDLGTTNSCVSVME-GGE----- sw|Q7NAU6|DNAK_MYCGA_Chaperone ---------------MTMSNNNGLIIGIDLGTTNSCVSVME-GAQ----- sw|P75344|DNAK_MYCPN_Chaperone -----------------MSTDNGLIIGIDLGTTNSCVSVME-NGR----- sw|Q51382|HSCA_PSEAE_Chaperone ----MALLQIAEPGQSPKPHERRLAVGIDLGTTNSLVAAVR-SGV----- sw|Q886Z7|HSCA_PSESM_Chaperone ----MALLQIAEPGLSPQPHQRRLAVGIDLGTTNSLVAAVR-SGL----- sw|Q8Y0L9|HSCA_RALSO_Chaperone ----MALLQISEPGESPAPHQRRLAVGIDLGTTNSLVAAVR-SSV----- sw|P32444|MBL_BACC1_MreB-like_ --------------------MFARDIGIDLGTANVLIHVKG--------- sw|P39751|MBL_BACSU_MreB-like_ --------------------MFARDIGIDLGTANVLIHVKG--------- sw|P0A9X5|MREB_ECOL6_Rod_shape -------------MLKKFRGMFSNDLSIDLGTANTLIYVKG--------- sw|P0A9X4|MREB_ECOLI_Rod_shape -------------MLKKFRGMFSNDLSIDLGTANTLIYVKG--------- sw|P0A9X7|MREB_SALTI_Rod_shape -------------MLKKFRGMFSNDLSIDLGTANTLIYVKG--------- sw|P0A9X6|MREB_SALTY_Rod_shape -------------MLKKFRGMFSNDLSIDLGTANTLIYVKG--------- sw|P0A9X8|MREB_SHIFL_Rod_shape -------------MLKKFRGMFSNDLSIDLGTANTLIYVKG--------- sw|P44474|MREB_HAEIN_Rod_shape ------------MLFKKIRGLFSNDLSIDLGTANTLIYVKR--------- sw|Q9L6A3|MREB_PASMU_Rod_shape ------------MLFKKIRGLFSNDLSIDLGTANTLIYVKG--------- sw|Q01465|MREB_BACSU_Rod_shape -----------------MFGIGARDLGIDLGTANTLVFVKG--------- sw|P39763|MREBH_BACSU_Protein_ -------------------MFQSTEIGIDLGTANILVYSKN--------- sw|O07827|FTSA_PORGI_Cell_divi -----------------MSRMNTIYAVIDLGSWYIRGMVARKMEDG---- sw|P49298|CISY_CITMA_Citrate_s ------------MASLRSATALSRLRSRAGQQSNLSNSVRWLQMQSSADL sw|P57309|FTSA_BUCAI_Cell_divi ------NIKIIGFGTCLSK-----GIDKGKINNLDLIVSCIQESINKAEI sw|O51928|FTSA_BUCAP_Cell_divi ------KIKIIGIGICQSN-----GIDKGRINNLDAVISCIRESIHQAEI sw|Q89AQ4|FTSA_BUCBP_Cell_divi ------TINIIGIGLSKSI-----GIDRGIINDLKSIVECIKKVINQAET sw|P0ABH2|FTSA_ECO57_Cell_divi ------MVNIIGVGSCPSR-----GMDKGGVNDLESVVKCVQRAIDQAEL sw|P0ABH3|FTSA_SHIFL_Cell_divi ------MVNIIGVGSCPSR-----GMDKGGVNDLESVVKCVQRAIDQAEL sw|P0ABH1|FTSA_ECOL6_Cell_divi ------MVNIIGVGSCPSR-----GMDKGGVNDLESVVKCVQRAIDQAEL sw|P0ABH0|FTSA_ECOLI_Cell_divi ------MVNIIGVGSCPSR-----GMDKGGVNDLESVVKCVQRAIDQAEL sw|P45068|FTSA_HAEIN_Cell_divi ------VVNVLGVGSCPSK-----GIDRGSITDLDAVVGSIQRAIEAAES sw|P47203|FTSA_PSEAE_Cell_divi ------QLEVVGIGTHPSR-----GLKKGVVVNIESTVQSIQRAIDEAQQ sw|Q44774|FTSA_BORBU_Cell_divi ------QLEIVGIGTSISR-----GVRKGVLINIEAALDSISNSIEAAEL sw|O07111|FTSA_ENTFA_Cell_divi ------QMNIIGVGNAKSD-----GLNRGIVVDIDQTVQAIQRAVRQAEE sw|O07672|FTSA_ENTHR_Cell_divi ------QMNIIGVGNAKSE-----GINRGIIVDIDKTVQAIQRAVRQAEE sw|P28264|FTSA_BACSU_Cell_divi ------SLNIIGVGNVPSE-----GLKKGSIVDIDETVHSIRKAFDQAER sw|Q5HGP6|FTSA_STAAC_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|P63764|FTSA_STAAM_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|P63765|FTSA_STAAN_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|Q6GA27|FTSA_STAAS_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|Q8NX33|FTSA_STAAW_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|Q6GHQ0|FTSA_STAAR_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|O07325|FTSA_STAAU_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|Q5HQ07|FTSA_STAEQ_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|Q8CPK5|FTSA_STAES_Cell_divi ------GINVIGTGQTYTS-----GIKNGLIDDFDIARQAIKDTIKKASI sw|P0A331|FTSA_AGRT5_Cell_divi LPGRTHKVEIIGIGHQRSR-----GVKSGVIADLDALEGVIRLSVDAAER sw|P0A332|FTSA_AGRTU_Cell_divi LPGRTHKVEIIGIGHQRSR-----GVKSGVIADLDALEGVIRLSVDAAER sw|O30994|FTSA_RHIME_Cell_divi LPGRTHSIEVIGIGHQKSR-----GVKNGVIADLDAVESVVRLAVDAAER sw|Q9ZKM3|FTSA_HELPJ_Cell_divi ------ILRIIGTAHQDSKEINSKAIKRGRINSLAHASNAIKEVINSAKK sw|O25629|FTSA_HELPY_Cell_divi ------ILRIIGTAHQDSKEINSKAIKRGRINSLAHASNAIKEVINSAKK sw|Q9HHB9|DNAK_HALME_Chaperone -----PEIIVNAEGDRTTPSVVAFTDDGERLVGKPAKNQAIQNPEHTIRS sw|Q9WYK6|DNAK_THEMA_Chaperone -----VEVIPNAEGSRVTPSVVAFTKSGEILVGEPAKRQMILNPERTIKS sw|Q9ZAD3|DNAK_PORGI_Chaperone -----PIVITNSEGKRTTPSVVAFVDGGERKVGDPAKRQAITNPTKTIYS sw|Q9XCB1|DNAK_RHOMR_Chaperone -----PKVIINPEGSRVTPSVVAFTADGEPLVGAPAKRQAITNPKNTIFS sw|Q8EPW4|DNAK_OCEIH_Chaperone -----AVVIPNPEGNRTSPSVVAFK-NGERQVGEVAKRQAITNPN-TIQS sw|Q7NAU6|DNAK_MYCGA_Chaperone -----KVVIENPEGKRTTPSVVSYK-NGEIIVGDAAKRQMLTNPN-TIVS sw|P75344|DNAK_MYCPN_Chaperone -----PVVLENPEGKRTTPSIVSYK-NNEIIVGDAAKRQMVTNPN-TIVS sw|Q51382|HSCA_PSEAE_Chaperone -----AEPLPDAQGRLILPSAVRYHAER-AEVGESARAAAAEDPFNTVIS sw|Q886Z7|HSCA_PSESM_Chaperone -----SEPLADAEGQVILPSAVRYHADR-VEVGQAAKAAASQDPFNTVLS sw|Q8Y0L9|HSCA_RALSO_Chaperone -----PEVLPDEQGRPLLPSVVRYLPAGGAQIGYKAQVEAVRDPKNTIVS sw|P32444|MBL_BACC1_MreB-like_ -----KGIVLNEPSVVAIDRNT----GKVLAVGEEARSMVGRTPGNIVAI sw|P39751|MBL_BACSU_MreB-like_ -----KGIVLNEPSVVALDKNS----GKVLAVGEEARRMVGRTPGNIVAI sw|P0A9X5|MREB_ECOL6_Rod_shape -----QGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAI sw|P0A9X4|MREB_ECOLI_Rod_shape -----QGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAI sw|P0A9X7|MREB_SALTI_Rod_shape -----QGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAI sw|P0A9X6|MREB_SALTY_Rod_shape -----QGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAI sw|P0A9X8|MREB_SHIFL_Rod_shape -----QGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAI sw|P44474|MREB_HAEIN_Rod_shape -----QGIVLDEPSVVAIRQDRVGTLKSIAAVGKEAKLMLGRTPKSIVAI sw|Q9L6A3|MREB_PASMU_Rod_shape -----QGIVLDEPSVVAIRQERSGALKSIAAVGRDAKLMLGRTPKSIAAI sw|Q01465|MREB_BACSU_Rod_shape -----KGIVVREPSVVALQTDT----KSIVAVGNDAKNMIGRTPGNVVAL sw|P39763|MREBH_BACSU_Protein_ -----KGIILNEPSVVAVDTTT----KAVLAIGADAKNMIGKTPGKIVAV sw|O07827|FTSA_PORGI_Cell_divi ------RVSPISFYEEPANN----CIRHGCVHNIDEAAAIIRRIVNQLNE sw|P49298|CISY_CITMA_Citrate_s DLHSQLKEMIPEQQERLKKVKSDLGKAQLGNITIDVVIGGMRGMTGLLWE sw|P57309|FTSA_BUCAI_Cell_divi MADCQITS------------------------------VYLSLSNKYINC sw|O51928|FTSA_BUCAP_Cell_divi MANCQITS------------------------------VYLSLSSKYINC sw|Q89AQ4|FTSA_BUCBP_Cell_divi MANCNITS------------------------------IYLALSNKYINC sw|P0ABH2|FTSA_ECO57_Cell_divi MADCQISS------------------------------VYLALSGKHISC sw|P0ABH3|FTSA_SHIFL_Cell_divi MADCQISS------------------------------VYLALSGKHISC sw|P0ABH1|FTSA_ECOL6_Cell_divi MADCQISS------------------------------VYLALSGKHISC sw|P0ABH0|FTSA_ECOLI_Cell_divi MADCQISS------------------------------VYLALSGKHISC sw|P45068|FTSA_HAEIN_Cell_divi MADCQIMS------------------------------VTLAITGEHIQS sw|P47203|FTSA_PSEAE_Cell_divi MAGCRIHS------------------------------AFVGIAGNHIRS sw|Q44774|FTSA_BORBU_Cell_divi ISGCDITS------------------------------LSVSMSGSSVEG sw|O07111|FTSA_ENTFA_Cell_divi KAGIQIKS------------------------------VNVGLPANLLEV sw|O07672|FTSA_ENTHR_Cell_divi KAGIQIKG------------------------------VSVGLPANLLEV sw|P28264|FTSA_BACSU_Cell_divi MVGFPLRK------------------------------AIVGVNGNYINI sw|Q5HGP6|FTSA_STAAC_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|P63764|FTSA_STAAM_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|P63765|FTSA_STAAN_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|Q6GA27|FTSA_STAAS_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|Q8NX33|FTSA_STAAW_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|Q6GHQ0|FTSA_STAAR_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|O07325|FTSA_STAAU_Cell_divi ASGVDIKE------------------------------VFLKLPIIGTEV sw|Q5HQ07|FTSA_STAEQ_Cell_divi ASGVDIKD------------------------------VFLKLPIIGTEV sw|Q8CPK5|FTSA_STAES_Cell_divi ASGVDIKD------------------------------VFLKLPIIGTEV sw|P0A331|FTSA_AGRT5_Cell_divi MAGLTVDS------------------------------LIVNVSAGRLAS sw|P0A332|FTSA_AGRTU_Cell_divi MAGLTVDS------------------------------LIVNVSAGRLAS sw|O30994|FTSA_RHIME_Cell_divi MAGLTIDS------------------------------LIVNVSAGRLQS sw|Q9ZKM3|FTSA_HELPJ_Cell_divi MAGLNADEDRNNPISSFRESYHPKTK------------AIVSFSGAYTES sw|O25629|FTSA_HELPY_Cell_divi MAGLNADEDRNNPMP-HFGEYHPKTK------------AIVSFSGAYTES sw|Q9HHB9|DNAK_HALME_Chaperone IKRHMGDDGYTVDIEGEE-------------------------YTPEQIS sw|Q9WYK6|DNAK_THEMA_Chaperone IKRKMG-TDYKVRIDDKE-------------------------YTPQEIS sw|Q9ZAD3|DNAK_PORGI_Chaperone IKRFMGETYDQVSREVERVPFKVVRGDNNTPRVDIDG----RLYTPQEIS sw|Q9XCB1|DNAK_RHOMR_Chaperone IKRFMGRFYDEVTEEISMVPYKVVRGENNTVRVEVEVGGEKRLYTPQEIS sw|Q8EPW4|DNAK_OCEIH_Chaperone IKRHMGTDYKVKIEEKE--------------------------YTPQEVS sw|Q7NAU6|DNAK_MYCGA_Chaperone IKRLMGTSKKVKINDK----------------------GVEKELTPEEVS sw|P75344|DNAK_MYCPN_Chaperone IKRLMGTSNKVTVKNPD---------------------GSTKELTPEEVS sw|Q51382|HSCA_PSEAE_Chaperone VKRLMGRGLEDVKQLGEQLPYRFR----QGESHMPFIETVQGLKSPVEVS sw|Q886Z7|HSCA_PSESM_Chaperone VKRLMGRGLSDVKQLGEQLPYRFV----GGESHMPFIDTVQGAKSPVEVS sw|Q8Y0L9|HSCA_RALSO_Chaperone VKRFMGRGLKDVAHIENTPYDFVD----APG--MVQLKTVAGVKSPVEVS sw|P32444|MBL_BACC1_MreB-like_ RPLKDG------------------------------------VIADFEIT sw|P39751|MBL_BACSU_MreB-like_ RPLKDG------------------------------------VIADFEVT sw|P0A9X5|MREB_ECOL6_Rod_shape RPMKDG------------------------------------VIADFFVT sw|P0A9X4|MREB_ECOLI_Rod_shape RPMKDG------------------------------------VIADFFVT sw|P0A9X7|MREB_SALTI_Rod_shape RPMKDG------------------------------------VIADFFVT sw|P0A9X6|MREB_SALTY_Rod_shape RPMKDG------------------------------------VIADFFVT sw|P0A9X8|MREB_SHIFL_Rod_shape RPMKDG------------------------------------VIADFFVT sw|P44474|MREB_HAEIN_Rod_shape RPMKDG------------------------------------VIADFFVT sw|Q9L6A3|MREB_PASMU_Rod_shape RPMKDG------------------------------------VIADFFVT sw|Q01465|MREB_BACSU_Rod_shape RPMKDG------------------------------------VIADYETT sw|P39763|MREBH_BACSU_Protein_ RPMKDG------------------------------------VIADYDMT sw|O07827|FTSA_PORGI_Cell_divi NLEDNTHIT-----------------------------SLYVGVGGQSIA sw|P49298|CISY_CITMA_Citrate_s TSLLDPDE---------------------------------GIRFRGLSI sw|P57309|FTSA_BUCAI_Cell_divi QNEIGIIPIS--DDEVTKEDIEHVIHIAQSVQILNEHHILHVIPQEYSID sw|O51928|FTSA_BUCAP_Cell_divi QNEIGIVPIS--EDEVTKEDIENVIHTAKSVKILNEHHILHVIPQEYSID sw|Q89AQ4|FTSA_BUCBP_Cell_divi QNEIGIIPIL--QEEITKNDIENVIHTAKSVRIRNEHKILHIIPQEYSID sw|P0ABH2|FTSA_ECO57_Cell_divi QNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAID sw|P0ABH3|FTSA_SHIFL_Cell_divi QNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAID sw|P0ABH1|FTSA_ECOL6_Cell_divi QNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAID sw|P0ABH0|FTSA_ECOLI_Cell_divi QNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAID sw|P45068|FTSA_HAEIN_Cell_divi LNESGFVPIA--ESEVTQEEIDSALHTASSIKLPEGLSLLHVIPQEYAVD sw|P47203|FTSA_PSEAE_Cell_divi LNSHGIVAIR--DREVNPADIERVLDAAQAVAIPADQRVLHTLAQDYVID sw|Q44774|FTSA_BORBU_Cell_divi TNSRGVVAINSKTREINEEDVERVIEAAKAIVIPMDREILHVIPQEFIVD sw|O07111|FTSA_ENTFA_Cell_divi ESCQGMIAVSSESKEITDEDVRNVASAALVRSTPPERQIVAILPQDFTVD sw|O07672|FTSA_ENTHR_Cell_divi ENCQGMIAVNGDSKEITDEDVRNVASAALVRSIPPERQIVSILPQDFTVD sw|P28264|FTSA_BACSU_Cell_divi QDTNGVVAVSSENKEIQVEDVRRVMAAAQVVSVPHEQLIVDVIPKQFIVD sw|Q5HGP6|FTSA_STAAC_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|P63764|FTSA_STAAM_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|P63765|FTSA_STAAN_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|Q6GA27|FTSA_STAAS_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|Q8NX33|FTSA_STAAW_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|Q6GHQ0|FTSA_STAAR_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|O07325|FTSA_STAAU_Cell_divi YDESNEIDFYEDT-EINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVD sw|Q5HQ07|FTSA_STAEQ_Cell_divi YDESNEIEFYEDT-EIDGTHIESVLEGIRDKNDVPETEVINVFPIRFVVD sw|Q8CPK5|FTSA_STAES_Cell_divi YDESNEIEFYEDT-EIDGTHIESVLEGIRDKNDVPETEVINVFPIRFVVD sw|P0A331|FTSA_AGRT5_Cell_divi DIYTASIDLG--GQEVEASDLRKVLVAASQQSMRQDRAILHSLPTGYSLD sw|P0A332|FTSA_AGRTU_Cell_divi DIYTASIDLG--GQEVEASDLRKVLVAASQQSMRQDRAILHSLPTGYSLD sw|O30994|FTSA_RHIME_Cell_divi DVYTATIDLG--GQEVEANDLKKVLAAAGHQSLRTDRAILHSLPTGFSLD sw|Q9ZKM3|FTSA_HELPJ_Cell_divi IRDVTGVASTKDNVVTIDEINRAINNACAKAGLDNDKHILHALPYRFTLD sw|O25629|FTSA_HELPY_Cell_divi IRDVTGVASTKDNVVTIDEINRAINSACAKAGLDNDKHILHALPYRFTLD sw|Q9HHB9|DNAK_HALME_Chaperone AMILQKIKRDAEDYLGDEV--EKAVITVPAYFNDKQRQATKDAGEIAGLE sw|Q9WYK6|DNAK_THEMA_Chaperone AFILKKLKNDAEAYLGGEI--KKAVITCPAYFNDAQRQATKEAGIIAGLE sw|Q9ZAD3|DNAK_PORGI_Chaperone AMILQKMKKTAEDYLGQEV--TEAVITVPAYFNDAQRQATKEAGEIAGLK sw|Q9XCB1|DNAK_RHOMR_Chaperone AMILQKLKQTAEEYLGVPV--TEAVITVPAYFNDAQRKATKEAGEIAGLK sw|Q8EPW4|DNAK_OCEIH_Chaperone AIILQYIKSYAEDYIGEKV--EKAVITVPAYFNDAERQATKDAGKIAGLE sw|Q7NAU6|DNAK_MYCGA_Chaperone ASILSYLKDYAEKKTGQKI--SRAVITVPAYFNDAERQATKTAGKIAGLT sw|P75344|DNAK_MYCPN_Chaperone AQILSYLKDYAEKKIGKTI--SRAVITVPAYFNDAERNATKTAGKIAGLN sw|Q51382|HSCA_PSEAE_Chaperone ADILRELRQRAETTLGGEL--VGAVITVPAYFDDAQRQATKDAARLAGLN sw|Q886Z7|HSCA_PSESM_Chaperone ADILKVLRQRAEAALGGEL--VGAVITVPAYFDDSQRQATKDAAKLAGLN sw|Q8Y0L9|HSCA_RALSO_Chaperone AEILATLRQRAEDTLGDDL--VGAVITVPAYFDDAQRQATKDAARLAGLN sw|P32444|MBL_BACC1_MreB-like_ EAMLKYFINKLDVKSFFSK--PRILICCPTNITSVEQKAIREAAERSGGK sw|P39751|MBL_BACSU_MreB-like_ EAMLKHFINKLNVKGLFSK--PRMLICCPTNITSVEQKAIKEAAEKSGGK sw|P0A9X5|MREB_ECOL6_Rod_shape EKMLQHFIKQVHSNSFMRP-SPRVLVCVPVGATQVERRAIRESAQGAGAR sw|P0A9X4|MREB_ECOLI_Rod_shape EKMLQHFIKQVHSNSFMRP-SPRVLVCVPVGATQVERRAIRESAQGAGAR sw|P0A9X7|MREB_SALTI_Rod_shape EKMLQHFIKQVHSNSFMRP-SPRVLVCVPVGATQVERRAIRESAQGAGAR sw|P0A9X6|MREB_SALTY_Rod_shape EKMLQHFIKQVHSNSFMRP-SPRVLVCVPVGATQVERRAIRESAQGAGAR sw|P0A9X8|MREB_SHIFL_Rod_shape EKMLQHFIKQVHSNSFMRP-SPRVLVCVPVGATQVERRAIRESAQGAGAR sw|P44474|MREB_HAEIN_Rod_shape EKMLQYFIKQVHSGNFMRP-SPRVLVCVPAGATQVERRAIKESAIGAGAR sw|Q9L6A3|MREB_PASMU_Rod_shape EKMLQYFIKQVHSSNFMRP-SPRVLVCVPAGATQVERRAIKESAIGAGAR sw|Q01465|MREB_BACSU_Rod_shape ATMMKYYINQAIKNKGMFTRKPYVMVCVPSGITAVEERAVIDATRQAGAR sw|P39763|MREBH_BACSU_Protein_ TDLLKHIMKKAAKSIGMSFRKPNVVVCTPSGSTAVERRAISDAVKNCGAK sw|O07827|FTSA_PORGI_Cell_divi SQEFIVRKAMVPEGEVIRTEHIESLWAEMRGASFPDKEVLDVTDPLFYVD sw|P49298|CISY_CITMA_Citrate_s PECQKLLPAAKPDGEPLPEGLLWLLLTGKVPSKEQVDGLSKELRDRATVP sw|P57309|FTSA_BUCAI_Cell_divi QQYGIKNPIGLSG-VRMQVKVHLITCHQNMARNIIKAVEKCDVKVDQVIF sw|O51928|FTSA_BUCAP_Cell_divi QQSGIKNPIGLSG-TRMQVRVHLITCHQNMAKNIIKAVEKCDIKVDQVIF sw|Q89AQ4|FTSA_BUCBP_Cell_divi ERTGIKNPIGLSG-IRMQAIVHLITCHSSIKKNIIKAVESCGIRVDYSVF sw|P0ABH2|FTSA_ECO57_Cell_divi YQEGIKNPVGLSG-VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF sw|P0ABH3|FTSA_SHIFL_Cell_divi YQEGIKNPVGLSG-VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF sw|P0ABH1|FTSA_ECOL6_Cell_divi YQEGIKNPVGLSG-VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF sw|P0ABH0|FTSA_ECOLI_Cell_divi YQEGIKNPVGLSG-VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF sw|P45068|FTSA_HAEIN_Cell_divi RQMNIKNPLGLQG-VRLKAQVHLIACHQDWQNNLKKAVERCGLQVDKVVF sw|P47203|FTSA_PSEAE_Cell_divi NQEGVREPLGMSG-VRLEAKVHVVTCAVNASQNIEKCVRRCGLEVDDIIL sw|Q44774|FTSA_BORBU_Cell_divi GIPHIKNPIDMMG-IRLEGEVHIITGSSSSSQNLVRCVNRAGFAVDEVVL sw|O07111|FTSA_ENTFA_Cell_divi GFEGIKDPRGMLG-VRMEMFGVVYTGPKTIIHNIRKCVEKAGLGINELVI sw|O07672|FTSA_ENTHR_Cell_divi GFEGIKDPRGMIG-VRLEMYGLLFTGPKTIVHNIRKCVENAGLVVNELVI sw|P28264|FTSA_BACSU_Cell_divi GRDEITDPKKMLG-VRLEVEGTLITGSKTILHNLLRCVERAGIEITDICL sw|Q5HGP6|FTSA_STAAC_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|P63764|FTSA_STAAM_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|P63765|FTSA_STAAN_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|Q6GA27|FTSA_STAAS_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|Q8NX33|FTSA_STAAW_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|Q6GHQ0|FTSA_STAAR_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|O07325|FTSA_STAAU_Cell_divi KENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|Q5HQ07|FTSA_STAEQ_Cell_divi KDNEVSDPKELIARHSLKVDAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|Q8CPK5|FTSA_STAES_Cell_divi KDNEVSDPKELIARHSLKVDAGVIAIQKSILINMIKCVEACGVDVLDVYS sw|P0A331|FTSA_AGRT5_Cell_divi GERGIRDPLSMYG-DLLGVDMHVVTVERTALKNLELCVNRAHLSVEGMVA sw|P0A332|FTSA_AGRTU_Cell_divi GERGIRDPLSMYG-DLLGVDMHVVTVERTALKNLELCVNRAHLSVEGMVA sw|O30994|FTSA_RHIME_Cell_divi GERGIRDPLAMFG-DVLGVDMHVLTAERPALKNLELCVNRAHLSVEGMVA sw|Q9ZKM3|FTSA_HELPJ_Cell_divi KQE-VNDPLGMSG-TRLEVFIHIVYTEKNNIENLEKIMIQSGVEIENIVI sw|O25629|FTSA_HELPY_Cell_divi KQE-VNDPLGMSG-TRLEVFIHIVYTEKNNIENLEKIMIQSGVEIENIVI sw|Q9HHB9|DNAK_HALME_Chaperone VERIVNEPTAASMAYGLDDESNQ-TVLVYDLGGGTFDVSVLDLGGGVYEV sw|Q9WYK6|DNAK_THEMA_Chaperone VLRIINEPTAAALAYGLDKAGKEEKVLVYDLGGGTFDVSILEIGEGVIEV sw|Q9ZAD3|DNAK_PORGI_Chaperone VRRIVNEPTAASLAYGLDKSNKDMKIAVFDLGGGTFDISILELGDGVFEV sw|Q9XCB1|DNAK_RHOMR_Chaperone VRRILNEPTAAALAYGLDKKDKELKIAVYDLGGGTYDISILELGDGVFEV sw|Q8EPW4|DNAK_OCEIH_Chaperone VERIINEPTAAALAYGIDKEDQDQTILVYDLGGGTFDVSILDIGDGTFEV sw|Q7NAU6|DNAK_MYCGA_Chaperone VERIINEPTAAALAYGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTFEV sw|P75344|DNAK_MYCPN_Chaperone VERIINEPTAAALAYGIDKSNREMKVLVYDLGGGTFDVSLLDIAEGTFEV sw|Q51382|HSCA_PSEAE_Chaperone VLRLLNEPTAAAVAYGLDK-GAEGLVAIYDLGGGTFDISILRLTRGVFEV sw|Q886Z7|HSCA_PSESM_Chaperone VLRLLNEPTAAAVAYGLDQ-KAEGVIAIYDLGGGTFDISILRLTGGVFEV sw|Q8Y0L9|HSCA_RALSO_Chaperone VLRLLNEPTAAAIAYGLDN-AAEGVYAVYDLGGGTFDISVLKLTKGVFEV sw|P32444|MBL_BACC1_MreB-like_ TVFLEEEPKVAAVGAGMEIFQPS-GNMVVDIGGGTTDIAVLSMGD----- sw|P39751|MBL_BACSU_MreB-like_ HVYLEEEPKVAAIGAGMEIFQPS-GNMVVDIGGGTTDIAVISMGD----- sw|P0A9X5|MREB_ECOL6_Rod_shape EVFLIEEPMAAAIGAGLPVSEAT-GSMVVDIGGGTTEVAVISLNG----- sw|P0A9X4|MREB_ECOLI_Rod_shape EVFLIEEPMAAAIGAGLPVSEAT-GSMVVDIGGGTTEVAVISLNG----- sw|P0A9X7|MREB_SALTI_Rod_shape EVFLIEEPMAAAIGAGLPVSEAT-GSMVVDIGGGTTEVAVISLNG----- sw|P0A9X6|MREB_SALTY_Rod_shape EVFLIEEPMAAAIGAGLPVSEAT-GSMVVDIGGGTTEVAVISLNG----- sw|P0A9X8|MREB_SHIFL_Rod_shape EVFLIEEPMAAAIGAGLPVSEAT-GSMVVDIGGGTTEVAVISLNG----- sw|P44474|MREB_HAEIN_Rod_shape EVYLIEEPMAAAIGAKLPVSTAV-GSMVIDIGGGTTEVAVISLNG----- sw|Q9L6A3|MREB_PASMU_Rod_shape EVYLIEEPMAAAIGAKLPVSTAT-GSMVIDIGGGTTEVAVISLNG----- sw|Q01465|MREB_BACSU_Rod_shape DAYPIEEPFAAAIGANLPVWEPT-GSMVVDIGGGTTEVAIISLGG----- sw|P39763|MREBH_BACSU_Protein_ NVHLIEEPVAAAIGADLPVDEPV-ANVVVDIGGGTTEVAIISFGG----- sw|O07827|FTSA_PORGI_Cell_divi GKQEIQAKG-VFCHELEARFQLITARRSVKQNIRIAIEERLGLRLTGILV sw|P49298|CISY_CITMA_Citrate_s DYVYKAIDALPVSAHPMTQFASGVMALQVQSEFQEAYEKGIHKSKSWEPT sw|P57309|FTSA_BUCAI_Cell_divi SGLASSKAVLTEDECNLGVCMIDIGGGTIDFTIYIDGSIKYSQVIPYAGN sw|O51928|FTSA_BUCAP_Cell_divi SGLASSKAVLTEDECKLGVCMIDIGGGTIDLITYIDGSIQDSQVIPYAGN sw|Q89AQ4|FTSA_BUCBP_Cell_divi SGLASSESVLTTDERNLGVCIVDIGGGTTDIAIYTNGTLKHSCVIPYAGN sw|P0ABH2|FTSA_ECO57_Cell_divi AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN sw|P0ABH3|FTSA_SHIFL_Cell_divi AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN sw|P0ABH1|FTSA_ECOL6_Cell_divi AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN sw|P0ABH0|FTSA_ECOLI_Cell_divi AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN sw|P45068|FTSA_HAEIN_Cell_divi SGFAATHSVLTEDEKDLGVCLIDFGAGTMNVMVYTNGALRFSKVIPYAGN sw|P47203|FTSA_PSEAE_Cell_divi EQLASAYSVLTEDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGD sw|Q44774|FTSA_BORBU_Cell_divi GSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVN sw|O07111|FTSA_ENTFA_Cell_divi TPLALTETILTDGEKDFGTIVIDMGGGQTTTSVIHDKQLKFTHVNQEGGE sw|O07672|FTSA_ENTHR_Cell_divi TPLALTETILSDGEKDFGTIVIDMGGGQTTTAVMHDKQLKFTSLDQEGGE sw|P28264|FTSA_BACSU_Cell_divi QPLAAGSAALSKDEKNLGVALIDIGGGSTTIAVFQNGHLTSTRVIPLGGE sw|Q5HGP6|FTSA_STAAC_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|P63764|FTSA_STAAM_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|P63765|FTSA_STAAN_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|Q6GA27|FTSA_STAAS_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|Q8NX33|FTSA_STAAW_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|Q6GHQ0|FTSA_STAAR_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|O07325|FTSA_STAAU_Cell_divi DAYNYG-SILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGR sw|Q5HQ07|FTSA_STAEQ_Cell_divi DAYNYG-SILTPTEKELGACVIDIGEDLTQVAFYERGELVDAESIEMAGR sw|Q8CPK5|FTSA_STAES_Cell_divi DAYNYG-FILTPTEKELGACVIDIGEDLTQVAFYERGELVDAESIEMAGR sw|P0A331|FTSA_AGRT5_Cell_divi TPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGRLIHTDAIGLGGH sw|P0A332|FTSA_AGRTU_Cell_divi TPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGRLIHTDAIGLGGH sw|O30994|FTSA_RHIME_Cell_divi TPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGKLVHADAVGLGGH sw|Q9ZKM3|FTSA_HELPJ_Cell_divi NSYAASIATLSNDERELGVACVDMGGETCNLTIYSGNSIRYNKYLPVGSH sw|O25629|FTSA_HELPY_Cell_divi NSYAASIATLSNDERELGVACVDMGGETCNLTIYSGNSIRYNKYLPVGSH sw|Q9HHB9|DNAK_HALME_Chaperone VATNGDNELGGDDWDEAIIDWLATEFKNDH-GIDLREDRQALQRLKDAAE sw|Q9WYK6|DNAK_THEMA_Chaperone IATAGNNHLGGDDFDQRLIDWMAEEFKKQH-GIDLREDRQALQRLRDAAE sw|Q9ZAD3|DNAK_PORGI_Chaperone KSTNGDTHLGGDDFDHVIIDWLAEEFKSQE-GVDLRQDPMAMQRLKEAAE sw|Q9XCB1|DNAK_RHOMR_Chaperone KATNGDTHLGGDNFDQRLIDYIADEFQKQE-GIDLRKDPMALQRLKEAAE sw|Q8EPW4|DNAK_OCEIH_Chaperone VSTAGDNRLGGDDFDQVIIDHMVQEFKKEN-AIDLSQDKMATQRLKDAAE sw|Q7NAU6|DNAK_MYCGA_Chaperone MATAGDNRLGGDDWDNKIIEWIIAEIKKDHPSLDLKSDKMAMQRLKEAAE sw|P75344|DNAK_MYCPN_Chaperone LATAGDNRLGGDDWDNKIIEFILAHIAQEHNGLNLSNDKMAMQRLKEAAE sw|Q51382|HSCA_PSEAE_Chaperone LATGGDTALGGDDFDHAIAGWVIEQA-----GLSADLDPGSQRQLLQIAC sw|Q886Z7|HSCA_PSESM_Chaperone LATGGDTALGGDDFDHAIASWIVADA-----GLSADLDPSAQRSLLQAAC sw|Q8Y0L9|HSCA_RALSO_Chaperone MSTGGDSALGGDDFDQRIACWIVEQA-----GLQP-LSAEDMRLLLNKAR sw|P32444|MBL_BACC1_MreB-like_ IVTSSSIKMAGDKFDMEILNYIKRKYK--------------LLIGERTSE sw|P39751|MBL_BACSU_MreB-like_ IVTSSSIKMAGDKFDMEILNYIKREYK--------------LLIGERTAE sw|P0A9X5|MREB_ECOL6_Rod_shape VVYSSSVRIGGDRFDEAIINYVRRNYG--------------SLIGEATAE sw|P0A9X4|MREB_ECOLI_Rod_shape VVYSSSVRIGGDRFDEAIINYVRRNYG--------------SLIGEATAE sw|P0A9X7|MREB_SALTI_Rod_shape VVYSSSVRIGGDRFDEAIINYVRRNYG--------------SLIGEATAE sw|P0A9X6|MREB_SALTY_Rod_shape VVYSSSVRIGGDRFDEAIINYVRRNYG--------------SLIGEATAE sw|P0A9X8|MREB_SHIFL_Rod_shape VVYSSSVRIGGDRFDEAIINYVRRNYG--------------SLIGEATAE sw|P44474|MREB_HAEIN_Rod_shape IVYSSSVRIGGDRFDEAIISYVRRTFG--------------SVIGEPTAE sw|Q9L6A3|MREB_PASMU_Rod_shape IVYSSSVRIGGDRFDEAIISYVRKTFG--------------SIIGEPTAE sw|Q01465|MREB_BACSU_Rod_shape IVTSQSIRVAGDEMDDAIINYIRKTYN--------------LMIGDRTAE sw|P39763|MREBH_BACSU_Protein_ VVSCHSIRIGGDQLDEDIVSFVRKKYN--------------LLIGERTAE sw|O07827|FTSA_PORGI_Cell_divi TPLCEAQVLLSDDELTLGCCYVNIGAGCTSVSIYKNRLLAMLRVLPMGGY sw|P49298|CISY_CITMA_Citrate_s SEDSLNLIARVPVVAAYVYQRIYKDGKIIPKDDSLDYGGNFSHMLGFDDP : sw|P57309|FTSA_BUCAI_Cell_divi IVTSDISYAFSTSRDNA----------------ENIKIKYGSVKKPP-LG sw|O51928|FTSA_BUCAP_Cell_divi IVTKDISYAFSTSYSDS----------------EKIKIKYGSAIKLS-PG sw|Q89AQ4|FTSA_BUCBP_Cell_divi TVTNDISYVFNIPFMYA----------------EKIKIKYGYAMQSS-DI sw|P0ABH2|FTSA_ECO57_Cell_divi VVTSDIAYAFGTPPSDA----------------EAIKVRHGCALGSI-VG sw|P0ABH3|FTSA_SHIFL_Cell_divi VVTSDIAYAFGTPPSDA----------------EAIKVRHGCALGSI-VG sw|P0ABH1|FTSA_ECOL6_Cell_divi VVTSDIAYAFGTPPSDA----------------EAIKVRHGCALGSI-VG sw|P0ABH0|FTSA_ECOLI_Cell_divi VVTSDIAYAFGTPPSDA----------------EAIKVRHGCALGSI-VG sw|P45068|FTSA_HAEIN_Cell_divi IVTNDIAHACTISRAEA----------------ERIKVNYASAFYPARLH sw|P47203|FTSA_PSEAE_Cell_divi QVTNDIAMALRTPTQYA----------------EEIKIRYACALAKL-AG sw|Q44774|FTSA_BORBU_Cell_divi RVTLDIAQVWKVPEDVA----------------ENIKITAGIAHPSILES sw|O07111|FTSA_ENTFA_Cell_divi FITKDISIVLNTSFNNA----------------EALKINYGDAYPERTSA sw|O07672|FTSA_ENTHR_Cell_divi FVTKDISIVLNTSFNNA----------------EALKINYGDAYPERTSA sw|P28264|FTSA_BACSU_Cell_divi NITKDISIGLRTSTEEA----------------ERVKKQLGHAYYDEASE sw|Q5HGP6|FTSA_STAAC_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|P63764|FTSA_STAAM_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|P63765|FTSA_STAAN_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|Q6GA27|FTSA_STAAS_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|Q8NX33|FTSA_STAAW_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|Q6GHQ0|FTSA_STAAR_Cell_divi DITDDIAQGLNTSYETA----------------EKVKHQYGHAFYDSASD sw|O07325|FTSA_STAAU_Cell_divi DITRRYCTRIKALLMKL----------------LKKLNTNMVMHSMILLQ sw|Q5HQ07|FTSA_STAEQ_Cell_divi DITDDIAQGLNTTYDTA----------------EKVKHQYGHAFYDSASD sw|Q8CPK5|FTSA_STAES_Cell_divi DITDDIAQGLNTTYDTA----------------EKVKHQYGHAFYDSASD sw|P0A331|FTSA_AGRT5_Cell_divi HVTTDLARGLSTRIEDA----------------ERLKVVHGSALLNGADE sw|P0A332|FTSA_AGRTU_Cell_divi HVTTDLARGLSTRIEDA----------------ERLKVVHGSALLNGADE sw|O30994|FTSA_RHIME_Cell_divi HVTTDLARGLSTRIEDA----------------ERLKVVHGSALPNSADE sw|Q9ZKM3|FTSA_HELPJ_Cell_divi HLTTDLSHMLNTPFPYA----------------EEVKIKYGDLSFESGAE sw|O25629|FTSA_HELPY_Cell_divi HLTTDLSHMLNTPFPYA----------------EEVKIKYGDLSFEGGEE sw|Q9HHB9|DNAK_HALME_Chaperone EAKIELSSRKETTINLPFITATDSG-PVHLEYDLTRAKFESLTKDLIDRT sw|Q9WYK6|DNAK_THEMA_Chaperone KAKIELSTKMETDVSLPFIAVSPSGQPLHLEMRITRSLFESLTRDLVEMT sw|Q9ZAD3|DNAK_PORGI_Chaperone KAKIELSSTSSTEINLPYIMPVNGI-PKHLVMTLTRAKFEQLADRLIQAC sw|Q9XCB1|DNAK_RHOMR_Chaperone KAKIELSSAMKTTVNLPFITATAEG-PKHLVMEITRAKFEQLIEDLVART sw|Q8EPW4|DNAK_OCEIH_Chaperone KAKKDLSGVTQTQISLPFITAGDAG-PLHLEMTMSRAKFDELSSDLVERT sw|Q7NAU6|DNAK_MYCGA_Chaperone RAKIELSAQLETLISLPFIAVTPEG-PVNAELTLSRAKFEELTKDLLERT sw|P75344|DNAK_MYCPN_Chaperone RAKIELSAQLEAIISLPFLTVTEKG-PVNVELKLTRAKFEEITKQLLERT sw|Q51382|HSCA_PSEAE_Chaperone AAKERLTDEASVRVAYGDWS-----------GELSRATLDELIEPFVARS sw|Q886Z7|HSCA_PSESM_Chaperone SAKEALTDAEFVEVTHGEWR-----------GTLTRDALNALIEPMIARS sw|Q8Y0L9|HSCA_RALSO_Chaperone AAKEWLSGADSTEVDAVLSTGETVH------LVLTAETFAELTANLVQKT sw|P32444|MBL_BACC1_MreB-like_ DIKIKVG--------------------------TVFPG--ARSEELEIRG sw|P39751|MBL_BACSU_MreB-like_ DIKIKVA--------------------------TVFPD--ARHEEISIRG sw|P0A9X5|MREB_ECOL6_Rod_shape RIKHEIG--------------------------SAYP--GDEVREIEVRG sw|P0A9X4|MREB_ECOLI_Rod_shape RIKHEIG--------------------------SAYP--GDEVREIEVRG sw|P0A9X7|MREB_SALTI_Rod_shape RIKHEIG--------------------------SAYP--GDEVREIEVRG sw|P0A9X6|MREB_SALTY_Rod_shape RIKHEIG--------------------------SAYP--GDEVREIEVRG sw|P0A9X8|MREB_SHIFL_Rod_shape RIKHEIG--------------------------SAYP--GDEVREIEVRG sw|P44474|MREB_HAEIN_Rod_shape RIKQEIG--------------------------SAYIQEGDEIKEMEVHG sw|Q9L6A3|MREB_PASMU_Rod_shape RIKQEIG--------------------------SAFIQEGDEVREIEVHG sw|Q01465|MREB_BACSU_Rod_shape AIKMEIG--------------------------SAEAP--EESDNMEIRG sw|P39763|MREBH_BACSU_Protein_ QVKMEIG--------------------------HALIE--HIPEAMEIRG sw|O07827|FTSA_PORGI_Cell_divi NVTRDLTSLRLTEQEAEN----------------------MKLNHVSMIN sw|P49298|CISY_CITMA_Citrate_s KMLELMRLYVTIHSDHE-----------------GGNVSAHTGHLVASAL sw|P57309|FTSA_BUCAI_Cell_divi SSKNIDFSD---INCNFQQNLQQDALIDVIESRYVELLSLVQDQIVHLQK sw|O51928|FTSA_BUCAP_Cell_divi TSKNIDLSS---KYGNFQKNLQQDTVIEVIESRYNELLHLINNRILYVQK sw|Q89AQ4|FTSA_BUCBP_Cell_divi TEEEIKIVN---EDNTIIQTFHKDKLTEVIESRYIELLTLINEEIKNTQK sw|P0ABH2|FTSA_ECO57_Cell_divi KDESVEVPS---VGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQE sw|P0ABH3|FTSA_SHIFL_Cell_divi KDESVEVPS---VGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQE sw|P0ABH1|FTSA_ECOL6_Cell_divi KDESVEVPS---VGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQE sw|P0ABH0|FTSA_ECOLI_Cell_divi KDESVEVPS---VGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQE sw|P45068|FTSA_HAEIN_Cell_divi GDKKIEVAS---IGGRAPRSLTKSDLSLITSARYTELLGVVKDELDKLKA sw|P47203|FTSA_PSEAE_Cell_divi AGETIKVPS---VGDRPPRELSRQALAEVVEPRYDELFTLV-------QA sw|Q44774|FTSA_BORBU_Cell_divi QMETVIIPN---LGTRPPQEKSRKELSVIINSRLREIFEMMK-------A sw|O07111|FTSA_ENTFA_Cell_divi NEEFPVDV----IGKSEPVRVDERYLSEIIEARVEQILRKSK-------- sw|O07672|FTSA_ENTHR_Cell_divi NEEFPVDV----IGQSEPVKVDERYLSEVISARMEQIFNKAK-------- sw|P28264|FTSA_BACSU_Cell_divi DEIFEVTV----IGTNQKQTFTQQEAANIIEARVEEILEIVS-------- sw|Q5HGP6|FTSA_STAAC_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|P63764|FTSA_STAAM_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|P63765|FTSA_STAAN_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|Q6GA27|FTSA_STAAS_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|Q8NX33|FTSA_STAAW_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|Q6GHQ0|FTSA_STAAR_Cell_divi QDIFTVEQ----VDSDETVQYTQKDLSDFIEARVEEIFFEVF-------- sw|O07325|FTSA_STAAU_Cell_divi IKISSLLNR---LIVMKQYSIPQKDLSDFIEARVEEIFFEVF-------- sw|Q5HQ07|FTSA_STAEQ_Cell_divi QDVFSVDQ----VDSDEHVQYTQKDLSDFIEQRVEDIFFEVF-------- sw|Q8CPK5|FTSA_STAES_Cell_divi QDVFSVDQ----VDSDEHVQYTQKDLSDFIEQRVEDIFFEVF-------- sw|P0A331|FTSA_AGRT5_Cell_divi RDMISIPPIGE-DDRDQPSQVSRALVTRIVRARIEETLELIR-------D sw|P0A332|FTSA_AGRTU_Cell_divi RDMISIPPIGE-DDRDQPSQVSRALVTRIVRARIEETLELIR-------D sw|O30994|FTSA_RHIME_Cell_divi RDIISVPPIGE-DDRDQPTHVPRALVSRIVRARIEETLELIR-------D sw|Q9ZKM3|FTSA_HELPJ_Cell_divi TPSQSVQIPTTGSDGHESHIVPLSEIQTIMRERALETFKIIHR------- sw|O25629|FTSA_HELPY_Cell_divi TPSQNVQIPTTGSDGHESHIVPLSEIQTIMRERALETFKIIHR------- sw|Q9HHB9|DNAK_HALME_Chaperone VEPTEQALEDAGYGKDDIDDVILVGGSTRMPQVLDKVEEILG-SEPKKSV sw|Q9WYK6|DNAK_THEMA_Chaperone RGPIEQALNDAKLSPQDIDEIILVGGMTRVPMVQRFIKEFFG-KEPNKSV sw|Q9ZAD3|DNAK_PORGI_Chaperone VAPCETALKDAGMSRGDIDEVILVGGSTRIPAIQEIVEKIFG-KAPSKGV sw|Q9XCB1|DNAK_RHOMR_Chaperone IPPMEQALKDAKLRKEDIDEVILVGGSTRIPLVQRTVEEFFG-KKANKSV sw|Q8EPW4|DNAK_OCEIH_Chaperone MQPTRKALSDASLSKSDIDKVILVGGSTRIPAVQEAIKKELG-QDPSKGV sw|Q7NAU6|DNAK_MYCGA_Chaperone RNPIADVLKEAKVDPSQVDEILLVGGSTRMPAVQKLVESMIPNKAPNRTI sw|P75344|DNAK_MYCPN_Chaperone RNPISDVLREAKIKPEEINEILLVGGSTRMPAVQKLVESMVPGHSPNRSI sw|Q51382|HSCA_PSEAE_Chaperone LKSCRRAVRDSGVDLEEIRSVVMVGGSTRVPRVRTAVGELFG-CEPLTDI sw|Q886Z7|HSCA_PSESM_Chaperone LKACRRAVRDTGIELEEVEAVVMVGGSTRVPRVREAVAELFG-RQPLTQI sw|Q8Y0L9|HSCA_RALSO_Chaperone LAPVRRALRDAGVAVDEIQGVVLVGGATRMPVIRRAVAQLFG-RAPLTNL sw|P32444|MBL_BACC1_MreB-like_ RDMVTGLPRTITVCSEEITEALKENAAVIVQAAKGVLERTPP-------- sw|P39751|MBL_BACSU_MreB-like_ RDMVSGLPRTITVNSKEVEEALRESVAVIVQAAKQVLERTPP-------- sw|P0A9X5|MREB_ECOL6_Rod_shape RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPP-------- sw|P0A9X4|MREB_ECOLI_Rod_shape RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPP-------- sw|P0A9X7|MREB_SALTI_Rod_shape RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPP-------- sw|P0A9X6|MREB_SALTY_Rod_shape RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPP-------- sw|P0A9X8|MREB_SHIFL_Rod_shape RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPP-------- sw|P44474|MREB_HAEIN_Rod_shape HNLAEGAPRSFTLTSRDVLEAIQQPLNGIVAAVRTALEECQP-------- sw|Q9L6A3|MREB_PASMU_Rod_shape HNLAEGAPRSFKLTSRDVLEAIQAPLNGIVAAVRTALEECQP-------- sw|Q01465|MREB_BACSU_Rod_shape RDLLTGLPKTIEITGKEISNALRDTVSTIVEAVKSTLEKTPP-------- sw|P39763|MREBH_BACSU_Protein_ RDLVTGLPKTIMLQSNEIQDAMRESLLHILEAIRATLEDCPP-------- sw|O07827|FTSA_PORGI_Cell_divi DNKSNGSFRMTFADKFSEREFRSSEVNRLAKARMDEITANYLN------- sw|P49298|CISY_CITMA_Citrate_s SDPYLSFLAALNGLAGPLHGLANQEVLLWIKSVVDECGENVT-------T sw|P57309|FTSA_BUCAI_Cell_divi KLHKKGEKYELLSGIVLTG----------------GGSNISCLTDCAEKV sw|O51928|FTSA_BUCAP_Cell_divi KLYKEGRKYQLTGGIVLTG----------------GASTISFLTECAEKI sw|Q89AQ4|FTSA_BUCBP_Cell_divi KLKKSGRIHKLGAGIVLTG----------------GASNIKLFKNCAEKV sw|P0ABH2|FTSA_ECO57_Cell_divi KLRQQGVKHHLAAGIVLTG----------------GAAQIEGLAACAQRV sw|P0ABH3|FTSA_SHIFL_Cell_divi KLRQQGVKHHLAAGIVLTG----------------GAAQIEGLAACAQRV sw|P0ABH1|FTSA_ECOL6_Cell_divi KLRQQGVKHHLAAGIVLTG----------------GAAQIEGLAACAQRV sw|P0ABH0|FTSA_ECOLI_Cell_divi KLRQQGVKHHLAAGIVLTG----------------GAAQIEGLAACAQRV sw|P45068|FTSA_HAEIN_Cell_divi ELEAKHIKFELIAGVVITG----------------GGAQIEDLKECASNV sw|P47203|FTSA_PSEAE_Cell_divi ELRRSGYEDLIPAGIVLTG----------------GTSKMEGAVELAEEI sw|Q44774|FTSA_BORBU_Cell_divi EILKRGLYNKINGGIVLTG----------------GGALFPGISNLIEEV sw|O07111|FTSA_ENTFA_Cell_divi EVLDEIDAFELPGGVVLTG----------------GAASMPGIVDLAQEI sw|O07672|FTSA_ENTHR_Cell_divi EALDQIEALELPGGIVLTG----------------GAASLPGVVDLAQEI sw|P28264|FTSA_BACSU_Cell_divi EELRSMGITDLPGGFVLTG----------------GQAAMPGVMSLAQDV sw|Q5HGP6|FTSA_STAAC_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|P63764|FTSA_STAAM_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|P63765|FTSA_STAAN_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|Q6GA27|FTSA_STAAS_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|Q8NX33|FTSA_STAAW_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|Q6GHQ0|FTSA_STAAR_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|O07325|FTSA_STAAU_Cell_divi DVLQDLGLTKVNGGFIVTG----------------GSANLLGVKELLSDM sw|Q5HQ07|FTSA_STAEQ_Cell_divi DVLQELGLTKVNGGFVVTG----------------GSANLLGVKELLQDM sw|Q8CPK5|FTSA_STAES_Cell_divi DVLQELGLTKVNGGFVVTG----------------GSANLLGVKELLQDM sw|P0A331|FTSA_AGRT5_Cell_divi RIQKSGFSPIVGKRVVLTG----------------GASQLTGLPETARRI sw|P0A332|FTSA_AGRTU_Cell_divi RIQKSGFSPIVGKRVVLTG----------------GASQLTGLPETARRI sw|O30994|FTSA_RHIME_Cell_divi RIQRSGFSPIVGKRIVLTG----------------GASQLTGLPEAARRI sw|Q9ZKM3|FTSA_HELPJ_Cell_divi SIQDSGFEEHLGGGVVLTG----------------GMALMKGIKELARTH sw|O25629|FTSA_HELPY_Cell_divi SIQDSGLEEHLGGGVVLTG----------------GMALMKGIKELARTH sw|Q9HHB9|DNAK_HALME_Chaperone NPDEAVALGAAIQGGVLG----GEVDDIVLLDVTPLSLGIEVKGGLFERL sw|Q9WYK6|DNAK_THEMA_Chaperone NPDEAVAIGAAIQAAILAGTEGAKGRDIVLVDVTPLTLGIEVKGGLFEPI sw|Q9ZAD3|DNAK_PORGI_Chaperone NPDEVVAVGAAIQGGVLTG----EVKDVLLLDVTPLSLGIETMGGVMTRL sw|Q9XCB1|DNAK_RHOMR_Chaperone NPDEVVAIGAAIQAGVLSG----EVQDVLLLDVTPLNLGIETLGGVMTVL sw|Q8EPW4|DNAK_OCEIH_Chaperone NPDEVVALGAAIQGGVLQG----DVKDVLLLDVTPLSLGIETMGAVTTKL sw|Q7NAU6|DNAK_MYCGA_Chaperone NPDEVVAIGAAVQGGVLRG----DVKDILLLDVTPLTLAIETLGGVATPI sw|P75344|DNAK_MYCPN_Chaperone NPDEVVAIGAAIQGGVLRG----DVKDVLLLDVTPLTLSIETLGGVATPL sw|Q51382|HSCA_PSEAE_Chaperone DPDQVVAIGAAIQADALAG-NKR-GEELLLLDVIPLSLGLETMGGLMEKV sw|Q886Z7|HSCA_PSESM_Chaperone DPDQVVAIGAAIQADTLAG-NKRDGGELLLLDVIPLSLGLETMGGLMEKV sw|Q8Y0L9|HSCA_RALSO_Chaperone DPDQVVAIGAAMQASLLAG-NRAAGDDWLLLDVIPLSLGVETMGGLVEKI sw|P32444|MBL_BACC1_MreB-like_ ----ELSADIIDRGVILTG--------------------GGALLHGIDML sw|P39751|MBL_BACSU_MreB-like_ ----ELSADIIDRGVIITG--------------------GGALLNGLDQL sw|P0A9X5|MREB_ECOL6_Rod_shape ----ELASDISERGMVLTG--------------------GGALLRNLDRL sw|P0A9X4|MREB_ECOLI_Rod_shape ----ELASDISERGMVLTG--------------------GGALLRNLDRL sw|P0A9X7|MREB_SALTI_Rod_shape ----ELASDISERGMVLTG--------------------GGALLRNLDRL sw|P0A9X6|MREB_SALTY_Rod_shape ----ELASDISERGMVLTG--------------------GGALLRNLDRL sw|P0A9X8|MREB_SHIFL_Rod_shape ----ELASDISERGMVLTG--------------------GGALLRNLDRL sw|P44474|MREB_HAEIN_Rod_shape ----EHAADIFERGMVLTG--------------------GGALLRNIDIL sw|Q9L6A3|MREB_PASMU_Rod_shape ----EHAADIFERGMVLTG--------------------GGALIRNIDVL sw|Q01465|MREB_BACSU_Rod_shape ----ELAADIMDRGIVLTG--------------------GGALLRNLDKV sw|P39763|MREBH_BACSU_Protein_ ----ELSGDIVDRGVILTG--------------------GGALLNGIKEW sw|O07827|FTSA_PORGI_Cell_divi ILRLSGLLEDIGAGIILNG----------------GGTKINNYMAAMKKI sw|P49298|CISY_CITMA_Citrate_s EQLKDYVWKTLNSGKVVPG-------------------FGHGVLRKTDPR : sw|P57309|FTSA_BUCAI_Cell_divi FQKKVRVAKP----FNISGLIEKITEPCYSTVIGLLHYGK----ESYIN- sw|O51928|FTSA_BUCAP_Cell_divi FQKKIRIAKP----LNISGLTDNVTEPHYSTVVGLLHYGK----EFYFD- sw|Q89AQ4|FTSA_BUCBP_Cell_divi FNIPVRIGCPKKNNINTAKLTNNTQTGSLSTVIGLLYFGK----KYFYS- sw|P0ABH2|FTSA_ECO57_Cell_divi FHTQVRIGAP----LNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNG sw|P0ABH3|FTSA_SHIFL_Cell_divi FHTQVRIGAP----LNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNG sw|P0ABH1|FTSA_ECOL6_Cell_divi FHTQVRIGAP----LNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNG sw|P0ABH0|FTSA_ECOLI_Cell_divi FHTQVRIGAP----LNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNG sw|P45068|FTSA_HAEIN_Cell_divi FHCQVRIASP----LNITGLTDYVNRPQYSTVVGLLQYNYSNSDDDLISG sw|P47203|FTSA_PSEAE_Cell_divi FHMPVRLGVP----YSVKGLTDVVRNPIYSTGVGLLMYGLQKQSDGMSMS sw|Q44774|FTSA_BORBU_Cell_divi FNYPARIGLP----MSINGIGEEHIDPKFSSALGLVLYKH----EQQKFN sw|O07111|FTSA_ENTFA_Cell_divi FEANVKLYVPNHMGLRNPVFANVISIVEYSAQLNDIYHIAKYAIPGEKSK sw|O07672|FTSA_ENTHR_Cell_divi FGVNVKLYVPNQMGLRNPVFTNVISIVDYSANLSEVYQLAKIAVTGETVV sw|P28264|FTSA_BACSU_Cell_divi LQNNVRVQGPNYIGVRDPQYMTGVGLIQFACRNARIQGRKIGFKMPEEAI sw|Q5HGP6|FTSA_STAAC_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEET sw|P63764|FTSA_STAAM_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEET sw|P63765|FTSA_STAAN_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEET sw|Q6GA27|FTSA_STAAS_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDSEET sw|Q8NX33|FTSA_STAAW_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDSEET sw|Q6GHQ0|FTSA_STAAR_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEET sw|O07325|FTSA_STAAU_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEET sw|Q5HQ07|FTSA_STAEQ_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTISYQDNEEF sw|Q8CPK5|FTSA_STAES_Cell_divi VSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTISYQDNEEF sw|P0A331|FTSA_AGRT5_Cell_divi LARNVRIGRP----MGVAGLPVAAKGPAFSTACGLMIYPQVADIEIHAAQ sw|P0A332|FTSA_AGRTU_Cell_divi LARNVRIGRP----MGVAGLPVAAKGPAFSTACGLMIYPQVADIEIHAAQ sw|O30994|FTSA_RHIME_Cell_divi LARNVRIGRP----LGVSGLPAAAKGPAFSTAVGLMIYPQVADLETHAAG sw|Q9ZKM3|FTSA_HELPJ_Cell_divi FTNYPVRLATPVEKYNIMGMFEDLKDPRFSVVVGLILYKAGGHTNYERDS sw|O25629|FTSA_HELPY_Cell_divi FTNYPVRLAAPVEKYNIMGMFEDLKDPRFSVVVGLILYKAGGHTNYERDS sw|Q9HHB9|DNAK_HALME_Chaperone IEKNTTIPTEESKIFTTAADNQTTVQVRVFQGEREMAEDNELLGEFTLSG sw|Q9WYK6|DNAK_THEMA_Chaperone IPRNTKIPVRKSKIFTTVEDGQTEVEIRVYQGERPIARENIFLGSFKLVG sw|Q9ZAD3|DNAK_PORGI_Chaperone IDANTTIPTKKSEIFTTAVDNQPSVEIHVLQGERSLAKDNKSIGRFNLDG sw|Q9XCB1|DNAK_RHOMR_Chaperone IPANTTIPTRKSEIFTTASDNQTSVEIHVLQGNREMAADNRSLGRFILDG sw|Q8EPW4|DNAK_OCEIH_Chaperone IERNTTIPTSASQTFSTAADNQTAVDIHVLQGEREMASDNKTLGRFQLTD sw|Q7NAU6|DNAK_MYCGA_Chaperone IKRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGG sw|P75344|DNAK_MYCPN_Chaperone IKRNTTIPVSKSQIFSTAQDNQESVDVVVCQGERPMARDNKSLGRFNLGG sw|Q51382|HSCA_PSEAE_Chaperone IPRNTTIPVARAQEFTTYKDGQTAMMIHVLQGERELVKDCRSLARFELRG sw|Q886Z7|HSCA_PSESM_Chaperone IPRNTTIPVARGQEFTTYKDGQTAMKIHVLQGERELVSDCRSLARFELRG sw|Q8Y0L9|HSCA_RALSO_Chaperone IPRNSTIPVARAQEFTTFKDGQTAMAIHVLQGERELAGDCRSLARFELRG sw|P32444|MBL_BACC1_MreB-like_ LAEELKVPVLIAENPMHCVAVGTGIMLENIDRLPKRALR----------- sw|P39751|MBL_BACSU_MreB-like_ LAEELKVPVLVAENPMDCVAIGTGVMLDNMDKLPKRKLS----------- sw|P0A9X5|MREB_ECOL6_Rod_shape LMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE--------- sw|P0A9X4|MREB_ECOLI_Rod_shape LMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE--------- sw|P0A9X7|MREB_SALTI_Rod_shape LMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE--------- sw|P0A9X6|MREB_SALTY_Rod_shape LMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE--------- sw|P0A9X8|MREB_SHIFL_Rod_shape LMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE--------- sw|P44474|MREB_HAEIN_Rod_shape LSKESGVPVIIAEDPLTCVARGGGEALEMIDMHGGDIFSDEI-------- sw|Q9L6A3|MREB_PASMU_Rod_shape LSKETGVPVIIADDPLTCVARGGGEALEMIDMHGGDIFSDDI-------- sw|Q01465|MREB_BACSU_Rod_shape ISEETKMPVLIAEDPLDCVAIGTGKALEHIHLFKGKTR------------ sw|P39763|MREBH_BACSU_Protein_ LTEEIVVPVHVAQNPLESVAIGTGRSLEVIDKLQKAIK------------ sw|O07827|FTSA_PORGI_Cell_divi LGEVTPAKIRMDRIDTDNAISFIEEHISTIGLAYKATQPCTDYITTNLGE sw|P49298|CISY_CITMA_Citrate_s YTCQREFALKHLPDDPLFQLVSKLYEVVPPILTKLGKVKNPWPNVDAHSG sw|P57309|FTSA_BUCAI_Cell_divi -IDKKKKEHSFFE------------------------------------- sw|O51928|FTSA_BUCAP_Cell_divi -DTNQKREISFIE------------------------------------- sw|Q89AQ4|FTSA_BUCBP_Cell_divi -HRN-KNSYNFFK------------------------------------- sw|P0ABH2|FTSA_ECO57_Cell_divi EAEVEKRVTASVG------------------------------------- sw|P0ABH3|FTSA_SHIFL_Cell_divi EAEVEKRVTASVG------------------------------------- sw|P0ABH1|FTSA_ECOL6_Cell_divi EAEVEKRVTASVG------------------------------------- sw|P0ABH0|FTSA_ECOLI_Cell_divi EAEVEKRVTASVG------------------------------------- sw|P45068|FTSA_HAEIN_Cell_divi SDDSEGTFFESIW------------------------------------- sw|P47203|FTSA_PSEAE_Cell_divi VSGSSYSSDEPKA------------------------------------- sw|Q44774|FTSA_BORBU_Cell_divi KLKKVSSKVKRKN------------------------------------- sw|O07111|FTSA_ENTFA_Cell_divi PAQSVAVQQEVRY------------------DTYAEQPQEE--YEEFN-- sw|O07672|FTSA_ENTHR_Cell_divi AHHTTVEQEVTSY------------------DNDSYDAPEETVYDEPE-- sw|P28264|FTSA_BACSU_Cell_divi QEIAVSSSEEQEQ------------------HHHQNEVQQR--PKGKQ-- sw|Q5HGP6|FTSA_STAAC_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|P63764|FTSA_STAAM_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|P63765|FTSA_STAAN_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|Q6GA27|FTSA_STAAS_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|Q8NX33|FTSA_STAAW_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|Q6GHQ0|FTSA_STAAR_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESSDEEIYQSEDNH sw|O07325|FTSA_STAAU_Cell_divi EEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH sw|Q5HQ07|FTSA_STAEQ_Cell_divi EEEVIES-DKDSETKSSGFDWFKRKSNKKENDEVAPEAPREESYEDRENH sw|Q8CPK5|FTSA_STAES_Cell_divi EEEVIET-DKDTETKSSGFDWFKRKSNKKENDEVAPEAPREESYEDRENH sw|P0A331|FTSA_AGRT5_Cell_divi GGMFSPFGNGSGR------------------------------------- sw|P0A332|FTSA_AGRTU_Cell_divi GGMFSPFGNGSGR------------------------------------- sw|O30994|FTSA_RHIME_Cell_divi SGMFSTLG-GNSR------------------------------------- sw|Q9ZKM3|FTSA_HELPJ_Cell_divi KGIIRYHESDDYIRKAHQSNPTPHIHSSPTERNLSDLKTPSAPLNTAKND sw|O25629|FTSA_HELPY_Cell_divi KGVIRYHESDDYTRTAHQSSPTPHIHSSPTERNLSDLKAPSAPLNTAKND sw|Q9HHB9|DNAK_HALME_Chaperone IPPAPAGTPQIEVGFNIDENGIVNVSAEDKGSGNAESITIEGGAGLSDDE sw|Q9WYK6|DNAK_THEMA_Chaperone IPPAPRGVPQIEVTFDIDSDGIVHVSAKDLGSGKEQSMVVTGRHKLSEDE sw|Q9ZAD3|DNAK_PORGI_Chaperone IAPAPRQTPQIEVTFDIDANGILNVTAHDKATGKKQNIRIEASSGLSDDE sw|Q9XCB1|DNAK_RHOMR_Chaperone IPPAPRGVPQIEVTFDIDANGILHVSARDKATGKEQSIRIEASSGLTPEE sw|Q8EPW4|DNAK_OCEIH_Chaperone IPPAPRGMPQIEVSFDIDANGIVNVRAKDLGTNKEQSITIKSSSGLSDDE sw|Q7NAU6|DNAK_MYCGA_Chaperone IQPAPKGKPQIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENE sw|P75344|DNAK_MYCPN_Chaperone IQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEE sw|Q51382|HSCA_PSEAE_Chaperone IPPMVAGAAKIRVTFQVDADGLLGVSARELSSGVEASIQVKPSYGLTDGE sw|Q886Z7|HSCA_PSESM_Chaperone IPPMVAGAAKIRVTFQVDADGLLSVSAREMGSGIESSIQVKPSYGLTDDE sw|Q8Y0L9|HSCA_RALSO_Chaperone IPPMVAGAARIRVTYQVDADGLLSVSARETVSGVEASIAVKPSYGLGDDD sw|P32444|MBL_BACC1_MreB-like_ -------------------------------------------------- sw|P39751|MBL_BACSU_MreB-like_ -------------------------------------------------- sw|P0A9X5|MREB_ECOL6_Rod_shape -------------------------------------------------- sw|P0A9X4|MREB_ECOLI_Rod_shape -------------------------------------------------- sw|P0A9X7|MREB_SALTI_Rod_shape -------------------------------------------------- sw|P0A9X6|MREB_SALTY_Rod_shape -------------------------------------------------- sw|P0A9X8|MREB_SHIFL_Rod_shape -------------------------------------------------- sw|P44474|MREB_HAEIN_Rod_shape -------------------------------------------------- sw|Q9L6A3|MREB_PASMU_Rod_shape -------------------------------------------------- sw|Q01465|MREB_BACSU_Rod_shape -------------------------------------------------- sw|P39763|MREBH_BACSU_Protein_ -------------------------------------------------- sw|O07827|FTSA_PORGI_Cell_divi LVSQIETKEEIPANDTVQDLFAQGRQTERKENEQRDNTDRQREDTPKQTV sw|P49298|CISY_CITMA_Citrate_s VLLNHFGLAEARYYTVLFGVSRSLGICSQLIWDRALGLPLE--------- sw|P57309|FTSA_BUCAI_Cell_divi ----------------IIFKRINNWFKKEF-------------------- sw|O51928|FTSA_BUCAP_Cell_divi ----------------KWFQKISNWFKKEF-------------------- sw|Q89AQ4|FTSA_BUCBP_Cell_divi ----------------KWLQYINNWIKKEF-------------------- sw|P0ABH2|FTSA_ECO57_Cell_divi ----------------SWIKRLNSWLRKEF-------------------- sw|P0ABH3|FTSA_SHIFL_Cell_divi ----------------SWIKRLNSWLRKEFDANGLINGDRPIRBCEECA- sw|P0ABH1|FTSA_ECOL6_Cell_divi ----------------SWIKRLNSWLRKEF-------------------- sw|P0ABH0|FTSA_ECOLI_Cell_divi ----------------SWIKRLNSWLRKEF-------------------- sw|P45068|FTSA_HAEIN_Cell_divi ----------------QGVKKIVNKVRSEF-------------------- sw|P47203|FTSA_PSEAE_Cell_divi ----------------PVLERLKRWVQGNF-------------------- sw|Q44774|FTSA_BORBU_Cell_divi ----------------KISSKLKGWFLKEWF------------------- sw|O07111|FTSA_ENTFA_Cell_divi ----------ERESGEKVTGKIKDFFSNIFD------------------- sw|O07672|FTSA_ENTHR_Cell_divi ----------QKKSDEDVTTKIKGFFSKIFD------------------- sw|P28264|FTSA_BACSU_Cell_divi ----------KTQAEHNKQSKMKKLLSMFWE------------------- sw|Q5HGP6|FTSA_STAAC_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|P63764|FTSA_STAAM_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|P63765|FTSA_STAAN_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|Q6GA27|FTSA_STAAS_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|Q8NX33|FTSA_STAAW_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|Q6GHQ0|FTSA_STAAR_Cell_divi QEHKQNHEHVQDKD--KEESKFKKLMKSLFE------------------- sw|O07325|FTSA_STAAU_Cell_divi QEHKQNHEHVQDKDKDKEESKFKKLMKSLFE------------------- sw|Q5HQ07|FTSA_STAEQ_Cell_divi LEDEQ-----QTEGKAKEESKFKKLMKSLFE------------------- sw|Q8CPK5|FTSA_STAES_Cell_divi LEDEQ-----QTEGKAKEESKFKKLMKSLFE------------------- sw|P0A331|FTSA_AGRT5_Cell_divi ------------------IARVGQWLKESF-------------------- sw|P0A332|FTSA_AGRTU_Cell_divi ------------------IARVGQWLKESF-------------------- sw|O30994|FTSA_RHIME_Cell_divi ------------------FARMGQWLKESF-------------------- sw|Q9ZKM3|FTSA_HELPJ_Cell_divi D-----FLPIKPTEQKGFFQNLLDKISKIF-------------------- sw|O25629|FTSA_HELPY_Cell_divi D-----FLPIKPTEQKGFFKSFLDKISKFF-------------------- sw|Q9HHB9|DNAK_HALME_Chaperone IDRMQREAEQHAEEDKERRRAVEARNEAEGAVQRAETLLE-ENEENVDDE sw|Q9WYK6|DNAK_THEMA_Chaperone IKRMIEDAKRYEEQDKRLKEEIELKNRADDLAYSVEKTLK-EHGDKIPAD sw|Q9ZAD3|DNAK_PORGI_Chaperone IKRMKEEAQANAEADKKEKERIDKINQADSMIFQTEKQLK-ELGDKFPAD sw|Q9XCB1|DNAK_RHOMR_Chaperone IERMREEARRHAAEDRKRREQIEKLNQADSLIYMTEKNLR-EYGDKLPAD sw|Q8EPW4|DNAK_OCEIH_Chaperone VDRMVKEAEENADADKQRREEVDLRNEADQLIFTTDKTIK-DLDDKVSEE sw|Q7NAU6|DNAK_MYCGA_Chaperone IQRMIRDAEANKERDAIVKQRIEMRYEGEGIVNTINEILGSKEAEALPAQ sw|P75344|DNAK_MYCPN_Chaperone IQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKE sw|Q51382|HSCA_PSEAE_Chaperone IARMLKDSFDYAGDDKAARALREQQVEAQRLLEAVQSALDVDGERLLDEE sw|Q886Z7|HSCA_PSESM_Chaperone VTRMLKDSFEYAGDDKVARVLREHQVDAERLLEAVQGALDADGERLLDEE sw|Q8Y0L9|HSCA_RALSO_Chaperone IARMLQEGFQSAEEDMRRRALAEERVEGERLLEALSHALDADG-DLLSAD sw|P32444|MBL_BACC1_MreB-like_ -------------------------------------------------- sw|P39751|MBL_BACSU_MreB-like_ -------------------------------------------------- sw|P0A9X5|MREB_ECOL6_Rod_shape -------------------------------------------------- sw|P0A9X4|MREB_ECOLI_Rod_shape -------------------------------------------------- sw|P0A9X7|MREB_SALTI_Rod_shape -------------------------------------------------- sw|P0A9X6|MREB_SALTY_Rod_shape -------------------------------------------------- sw|P0A9X8|MREB_SHIFL_Rod_shape -------------------------------------------------- sw|P44474|MREB_HAEIN_Rod_shape -------------------------------------------------- sw|Q9L6A3|MREB_PASMU_Rod_shape -------------------------------------------------- sw|Q01465|MREB_BACSU_Rod_shape -------------------------------------------------- sw|P39763|MREBH_BACSU_Protein_ -------------------------------------------------- sw|O07827|FTSA_PORGI_Cell_divi KKKEKTGPSFGDKLKGAFIKFGSLFDEDTNQDNNR--------------- sw|P49298|CISY_CITMA_Citrate_s ----------------RPKSVTLDWIEKNCKKAA---------------- sw|P57309|FTSA_BUCAI_Cell_divi -------------------------------------------------- sw|O51928|FTSA_BUCAP_Cell_divi -------------------------------------------------- sw|Q89AQ4|FTSA_BUCBP_Cell_divi -------------------------------------------------- sw|P0ABH2|FTSA_ECO57_Cell_divi -------------------------------------------------- sw|P0ABH3|FTSA_SHIFL_Cell_divi -------------------------------------------------- sw|P0ABH1|FTSA_ECOL6_Cell_divi -------------------------------------------------- sw|P0ABH0|FTSA_ECOLI_Cell_divi -------------------------------------------------- sw|P45068|FTSA_HAEIN_Cell_divi -------------------------------------------------- sw|P47203|FTSA_PSEAE_Cell_divi -------------------------------------------------- sw|Q44774|FTSA_BORBU_Cell_divi -------------------------------------------------- sw|O07111|FTSA_ENTFA_Cell_divi -------------------------------------------------- sw|O07672|FTSA_ENTHR_Cell_divi -------------------------------------------------- sw|P28264|FTSA_BACSU_Cell_divi -------------------------------------------------- sw|Q5HGP6|FTSA_STAAC_Cell_divi -------------------------------------------------- sw|P63764|FTSA_STAAM_Cell_divi -------------------------------------------------- sw|P63765|FTSA_STAAN_Cell_divi -------------------------------------------------- sw|Q6GA27|FTSA_STAAS_Cell_divi -------------------------------------------------- sw|Q8NX33|FTSA_STAAW_Cell_divi -------------------------------------------------- sw|Q6GHQ0|FTSA_STAAR_Cell_divi -------------------------------------------------- sw|O07325|FTSA_STAAU_Cell_divi -------------------------------------------------- sw|Q5HQ07|FTSA_STAEQ_Cell_divi -------------------------------------------------- sw|Q8CPK5|FTSA_STAES_Cell_divi -------------------------------------------------- sw|P0A331|FTSA_AGRT5_Cell_divi -------------------------------------------------- sw|P0A332|FTSA_AGRTU_Cell_divi -------------------------------------------------- sw|O30994|FTSA_RHIME_Cell_divi -------------------------------------------------- sw|Q9ZKM3|FTSA_HELPJ_Cell_divi -------------------------------------------------- sw|O25629|FTSA_HELPY_Cell_divi -------------------------------------------------- sw|Q9HHB9|DNAK_HALME_Chaperone LRADIEAAIEDVEAVLEDDDASTDELEDVTEDLSKELQEIGKRMYQQQAQ sw|Q9WYK6|DNAK_THEMA_Chaperone LKSRLEDMIRELRDAINRNDIP--KVKMLFDDLQKESMKIGEYLYKSATG sw|Q9ZAD3|DNAK_PORGI_Chaperone KKAPIDTALDKLKEAHKAQDVAAIDTAMAELQTALSAAGEELYKNAGAAQ sw|Q9XCB1|DNAK_RHOMR_Chaperone KRAKIESALERLKEVHKARNFDELDSAIAQLNQAWNEASQDLYR---AQQ sw|Q8EPW4|DNAK_OCEIH_Chaperone DKQKAESAKDELKQALESGDMEQVKAKKDALEEHVQQLSAKLYEQVQQEA sw|Q7NAU6|DNAK_MYCGA_Chaperone EKASLTKIVDGINGALKAEKWDELKEQIDGFKKWRDDMSKKYGGGEAPAE sw|P75344|DNAK_MYCPN_Chaperone EKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQ sw|Q51382|HSCA_PSEAE_Chaperone ERLAIAAQMDTLRELAGGSDTAAIENQIKRLSQVTDAFAARRMDATVKAA sw|Q886Z7|HSCA_PSESM_Chaperone ERLVINLQMDELRELMQGTDGYAIEQQTKRLSQVTDAFAARRLDSTVKAA sw|Q8Y0L9|HSCA_RALSO_Chaperone ERAAVDAQVAALRVTLQGEDHRAIKDAVDALSHGTDEFAARRMDRGIRAA sw|P32444|MBL_BACC1_MreB-like_ -------------------------------------------------- sw|P39751|MBL_BACSU_MreB-like_ -------------------------------------------------- sw|P0A9X5|MREB_ECOL6_Rod_shape -------------------------------------------------- sw|P0A9X4|MREB_ECOLI_Rod_shape -------------------------------------------------- sw|P0A9X7|MREB_SALTI_Rod_shape -------------------------------------------------- sw|P0A9X6|MREB_SALTY_Rod_shape -------------------------------------------------- sw|P0A9X8|MREB_SHIFL_Rod_shape -------------------------------------------------- sw|P44474|MREB_HAEIN_Rod_shape -------------------------------------------------- sw|Q9L6A3|MREB_PASMU_Rod_shape -------------------------------------------------- sw|Q01465|MREB_BACSU_Rod_shape -------------------------------------------------- sw|P39763|MREBH_BACSU_Protein_ -------------------------------------------------- sw|O07827|FTSA_PORGI_Cell_divi -------------------------------------------------- sw|P49298|CISY_CITMA_Citrate_s -------------------------------------------------- sw|P57309|FTSA_BUCAI_Cell_divi ----------------------------------------- sw|O51928|FTSA_BUCAP_Cell_divi ----------------------------------------- sw|Q89AQ4|FTSA_BUCBP_Cell_divi ----------------------------------------- sw|P0ABH2|FTSA_ECO57_Cell_divi ----------------------------------------- sw|P0ABH3|FTSA_SHIFL_Cell_divi ----------------------------------------- sw|P0ABH1|FTSA_ECOL6_Cell_divi ----------------------------------------- sw|P0ABH0|FTSA_ECOLI_Cell_divi ----------------------------------------- sw|P45068|FTSA_HAEIN_Cell_divi ----------------------------------------- sw|P47203|FTSA_PSEAE_Cell_divi ----------------------------------------- sw|Q44774|FTSA_BORBU_Cell_divi ----------------------------------------- sw|O07111|FTSA_ENTFA_Cell_divi ----------------------------------------- sw|O07672|FTSA_ENTHR_Cell_divi ----------------------------------------- sw|P28264|FTSA_BACSU_Cell_divi ----------------------------------------- sw|Q5HGP6|FTSA_STAAC_Cell_divi ----------------------------------------- sw|P63764|FTSA_STAAM_Cell_divi ----------------------------------------- sw|P63765|FTSA_STAAN_Cell_divi ----------------------------------------- sw|Q6GA27|FTSA_STAAS_Cell_divi ----------------------------------------- sw|Q8NX33|FTSA_STAAW_Cell_divi ----------------------------------------- sw|Q6GHQ0|FTSA_STAAR_Cell_divi ----------------------------------------- sw|O07325|FTSA_STAAU_Cell_divi ----------------------------------------- sw|Q5HQ07|FTSA_STAEQ_Cell_divi ----------------------------------------- sw|Q8CPK5|FTSA_STAES_Cell_divi ----------------------------------------- sw|P0A331|FTSA_AGRT5_Cell_divi ----------------------------------------- sw|P0A332|FTSA_AGRTU_Cell_divi ----------------------------------------- sw|O30994|FTSA_RHIME_Cell_divi ----------------------------------------- sw|Q9ZKM3|FTSA_HELPJ_Cell_divi ----------------------------------------- sw|O25629|FTSA_HELPY_Cell_divi ----------------------------------------- sw|Q9HHB9|DNAK_HALME_Chaperone AQAGGPGGAGGPGGADGPGADADPEDFVDADADFDDEDDDE sw|Q9WYK6|DNAK_THEMA_Chaperone GETSNQ----------------------------------- sw|Q9ZAD3|DNAK_PORGI_Chaperone GGAQPGPDFGGAQGPSAGDQPSDDKNVTDVDFEEVK----- sw|Q9XCB1|DNAK_RHOMR_Chaperone AAGAQTSDGASAQADSGGVREADYEVIDEDDKDKQ------ sw|Q8EPW4|DNAK_OCEIH_Chaperone QQAS-GEQGEESGNQDDDVVDADYSEVDDDDKK-------- sw|Q7NAU6|DNAK_MYCGA_Chaperone PK--------------------------------------- sw|P75344|DNAK_MYCPN_Chaperone PAQ-------------------------------------- sw|Q51382|HSCA_PSEAE_Chaperone LSGRRLNEIEE------------------------------ sw|Q886Z7|HSCA_PSESM_Chaperone LAGRNLNEIEE------------------------------ sw|Q8Y0L9|HSCA_RALSO_Chaperone LAGKRIEELG------------------------------- sw|P32444|MBL_BACC1_MreB-like_ ----------------------------------------- sw|P39751|MBL_BACSU_MreB-like_ ----------------------------------------- sw|P0A9X5|MREB_ECOL6_Rod_shape ----------------------------------------- sw|P0A9X4|MREB_ECOLI_Rod_shape ----------------------------------------- sw|P0A9X7|MREB_SALTI_Rod_shape ----------------------------------------- sw|P0A9X6|MREB_SALTY_Rod_shape ----------------------------------------- sw|P0A9X8|MREB_SHIFL_Rod_shape ----------------------------------------- sw|P44474|MREB_HAEIN_Rod_shape ----------------------------------------- sw|Q9L6A3|MREB_PASMU_Rod_shape ----------------------------------------- sw|Q01465|MREB_BACSU_Rod_shape ----------------------------------------- sw|P39763|MREBH_BACSU_Protein_ ----------------------------------------- sw|O07827|FTSA_PORGI_Cell_divi ----------------------------------------- sw|P49298|CISY_CITMA_Citrate_s -----------------------------------------
clustalw.dnd
( ( ( ( ( sw|P49298|CISY_CITMA_Citrate_s:0.48477, ( ( ( ( ( sw|Q9HHB9|DNAK_HALME_Chaperone:0.21623, sw|Q9WYK6|DNAK_THEMA_Chaperone:0.22337) :0.00270, ( sw|Q8EPW4|DNAK_OCEIH_Chaperone:0.20884, ( sw|Q9ZAD3|DNAK_PORGI_Chaperone:0.16922, sw|Q9XCB1|DNAK_RHOMR_Chaperone:0.15422) :0.04366) :0.01101) :0.02001, ( sw|Q7NAU6|DNAK_MYCGA_Chaperone:0.11001, sw|P75344|DNAK_MYCPN_Chaperone:0.10848) :0.13542) :0.06493, ( ( sw|Q51382|HSCA_PSEAE_Chaperone:0.08300, sw|Q886Z7|HSCA_PSESM_Chaperone:0.09147) :0.09161, sw|Q8Y0L9|HSCA_RALSO_Chaperone:0.17465) :0.14159) :0.09985, ( ( sw|P32444|MBL_BACC1_MreB-like_:0.06602, sw|P39751|MBL_BACSU_MreB-like_:0.06911) :0.17068, ( sw|P39763|MREBH_BACSU_Protein_:0.22730, ( sw|Q01465|MREB_BACSU_Rod_shape:0.20828, ( ( ( ( ( sw|P0A9X5|MREB_ECOL6_Rod_shape:0.00000, sw|P0A9X4|MREB_ECOLI_Rod_shape:0.00000) :0.00000, sw|P0A9X7|MREB_SALTI_Rod_shape:0.00000) :0.00000, sw|P0A9X6|MREB_SALTY_Rod_shape:0.00000) :0.00000, sw|P0A9X8|MREB_SHIFL_Rod_shape:0.00000) :0.09231, ( sw|P44474|MREB_HAEIN_Rod_shape:0.03202, sw|Q9L6A3|MREB_PASMU_Rod_shape:0.03066) :0.07087) :0.13215) :0.01916) :0.01587) :0.13026) :0.03441) :0.02267, sw|O07827|FTSA_PORGI_Cell_divi:0.43706) :0.02528, ( sw|Q9ZKM3|FTSA_HELPJ_Cell_divi:0.02268, sw|O25629|FTSA_HELPY_Cell_divi:0.02000) :0.35388) :0.00583, ( ( sw|P0A331|FTSA_AGRT5_Cell_divi:0.00000, sw|P0A332|FTSA_AGRTU_Cell_divi:0.00000) :0.07911, sw|O30994|FTSA_RHIME_Cell_divi:0.06342) :0.29713) :0.00474, ( ( sw|P28264|FTSA_BACSU_Cell_divi:0.29638, ( sw|O07111|FTSA_ENTFA_Cell_divi:0.10835, sw|O07672|FTSA_ENTHR_Cell_divi:0.10074) :0.21498) :0.02287, ( ( ( ( ( ( sw|Q5HGP6|FTSA_STAAC_Cell_divi:0.00000, sw|P63764|FTSA_STAAM_Cell_divi:0.00000) :0.00000, sw|P63765|FTSA_STAAN_Cell_divi:0.00000) :0.00098, ( sw|Q6GA27|FTSA_STAAS_Cell_divi:0.00000, sw|Q8NX33|FTSA_STAAW_Cell_divi:0.00000) :0.00114) :0.00090, sw|Q6GHQ0|FTSA_STAAR_Cell_divi:0.00124) :0.03743, sw|O07325|FTSA_STAAU_Cell_divi:0.05638) :0.03769, ( sw|Q5HQ07|FTSA_STAEQ_Cell_divi:0.00331, sw|Q8CPK5|FTSA_STAES_Cell_divi:0.00315) :0.07543) :0.30302) :0.02644, ( sw|Q44774|FTSA_BORBU_Cell_divi:0.31795, ( ( ( ( ( sw|P57309|FTSA_BUCAI_Cell_divi:0.12192, sw|O51928|FTSA_BUCAP_Cell_divi:0.11731) :0.09090, sw|Q89AQ4|FTSA_BUCBP_Cell_divi:0.21652) :0.02517, ( ( ( sw|P0ABH2|FTSA_ECO57_Cell_divi:-0.00013, sw|P0ABH3|FTSA_SHIFL_Cell_divi:0.00013) :0.00000, sw|P0ABH1|FTSA_ECOL6_Cell_divi:0.00000) :0.00000, sw|P0ABH0|FTSA_ECOLI_Cell_divi:0.00000) :0.20885) :0.03466, sw|P45068|FTSA_HAEIN_Cell_divi:0.26605) :0.04080, sw|P47203|FTSA_PSEAE_Cell_divi:0.27265) :0.03146) :0.02654);