spacer

Muscle Results


Results of search
Number of sequences 50
Sequence type Amino
Muscle version MUSCLE v3.6 by Robert C. Edgar
Max length 640
Average length 459
Output file muscle-20070626-10284825.output (clustalw)
Your input file muscle-20070626-10284825.input




Alignment

MUSCLE (3.6) multiple sequence alignment


sw|P49298|CISY_CITMA       -------------------MASLRSAT-ALSRLRSR------------------AGQQSN
sw|P32444|MBL_BACC1        -------------------MFARDIGI-DLGTANVLIHV---------------KGK---
sw|P39751|MBL_BACSU        -------------------MFARDIGI-DLGTANVLIHV---------------KGK---
sw|P39763|MREBH_BACSU      ------------------MFQSTEIGI-DLGTANILVYS---------------KNK---
sw|Q01465|MREB_BACSU       ----------------MFGIGARDLGI-DLGTANTLVFV---------------KGK---
sw|P0A9X5|MREB_ECOL6       ------------MLKKFRGMFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|P0A9X4|MREB_ECOLI       ------------MLKKFRGMFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|P0A9X7|MREB_SALTI       ------------MLKKFRGMFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|P0A9X6|MREB_SALTY       ------------MLKKFRGMFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|P0A9X8|MREB_SHIFL       ------------MLKKFRGMFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|P44474|MREB_HAEIN       -----------MLFKKIRGLFSNDLSI-DLGTANTLIYV---------------KRQ---
sw|Q9L6A3|MREB_PASMU       -----------MLFKKIRGLFSNDLSI-DLGTANTLIYV---------------KGQ---
sw|Q8Y0L9|HSCA_RALSO       ---MALLQISEPGESPAPHQRRLAVGI-DLGTTNSLVAAVR-------------SSVPEV
sw|Q51382|HSCA_PSEAE       ---MALLQIAEPGQSPKPHERRLAVGI-DLGTTNSLVAAVR-------------SGVAEP
sw|Q886Z7|HSCA_PSESM       ---MALLQIAEPGLSPQPHQRRLAVGI-DLGTTNSLVAAVR-------------SGLSEP
sw|Q7NAU6|DNAK_MYCGA       --------------MTMSNNNGLIIGI-DLGTTNSCVSVME-------------GAQKVV
sw|P75344|DNAK_MYCPN       ----------------MSTDNGLIIGI-DLGTTNSCVSVME-------------NGRPVV
sw|Q9HHB9|DNAK_HALME       ------------------MASNKILGI-DLGTTNSAFAVME-------------GGDPEI
sw|Q8EPW4|DNAK_OCEIH       --------------------MSKIIGI-DLGTTNSCVSVME-------------GGEAVV
sw|Q9WYK6|DNAK_THEMA       ----------------MAEKKEFVVGI-DLGTTNSVIAWMKP------------DGTVEV
sw|Q9ZAD3|DNAK_PORGI       --------------------MGKIIGI-DLGTTNSCVSVLE-------------GNEPIV
sw|Q9XCB1|DNAK_RHOMR       --------------------MGKIIGI-DLGTTNSVVAVME-------------GGEPKV
sw|O07827|FTSA_PORGI       ----------------MSRMNTIYAVI-DLGSWYIRGMVARKME----------DGRVSP
sw|P0A331|FTSA_AGRT5       MSFFGSSHFGLPRLKPLSSKRSHIVSVLDIGSTKVVCMIGRLTPRQESEILPGRTHKVEI
sw|P0A332|FTSA_AGRTU       MSFFGSSHFGLPRLKPLSSKRSHIVSVLDIGSTKVVCMIGRLTPRQESEILPGRTHKVEI
sw|O30994|FTSA_RHIME       MSLFGSANFGLPRLKPLPSKRSHVVSVLDIGSTKVVCMIGRLTPRAESQILPGRTHSIEV
sw|Q9ZKM3|FTSA_HELPJ       -----------------MEHKEIVIGV-DIGSRKICAIVAE-FK----------DGILRI
sw|O25629|FTSA_HELPY       -----------------MEHKEIVIGV-DLGSRKICAIVAE-FK----------EGILRI
sw|Q5HQ07|FTSA_STAEQ       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q8CPK5|FTSA_STAES       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|O07325|FTSA_STAAU       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q6GHQ0|FTSA_STAAR       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q6GA27|FTSA_STAAS       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q8NX33|FTSA_STAAW       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q5HGP6|FTSA_STAAC       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|P63764|FTSA_STAAM       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|P63765|FTSA_STAAN       ------------------MEEHYYVSI-DIGSSSVKTIVGEKF-----------HNGINV
sw|Q44774|FTSA_BORBU       ------------------MSRNLIVGL-DVGTSKICTVVAEVNL----------NDQLEI
sw|P47203|FTSA_PSEAE       --------------MASVQSGKMIVGL-DIGTSKVVALVGEVTA----------DGQLEV
sw|P45068|FTSA_HAEIN       --------------MVKGVETKTIVGL-EVGTSKVVVVVGEVFP----------DGVVNV
sw|P0ABH2|FTSA_ECO57       --------------MIKATDRKLVVGL-EIGTAKVAALVGEVLP----------DGMVNI
sw|P0ABH1|FTSA_ECOL6       --------------MIKATDRKLVVGL-EIGTAKVAALVGEVLP----------DGMVNI
sw|P0ABH0|FTSA_ECOLI       --------------MIKATDRKLVVGL-EIGTAKVAALVGEVLP----------DGMVNI
sw|P0ABH3|FTSA_SHIFL       --------------MIKATDRKLVVGL-EIGTAKVAALVGEVLP----------DGMVNI
sw|Q89AQ4|FTSA_BUCBP       --------------MIKVLKKKLIVGL-EIGTTKTTISVGEILE----------DDTINI
sw|P57309|FTSA_BUCAI       --------------MIISKDRKLVVGL-EIGTTKVVTLVGEVLI----------DDNIKI
sw|O51928|FTSA_BUCAP       --------------MIISKNRKLVVGL-EIGTTKVVTLVGEVLT----------NGKIKI
sw|P28264|FTSA_BACSU       -----------------MNNNELYVSL-DLGTSNTKVIVGEMT-----------GDSLNI
sw|O07111|FTSA_ENTFA       -----------------MAKTGMYVGL-DIGTTSVKVVVAEYI-----------EGQMNI
sw|O07672|FTSA_ENTHR       -----------------MAKTGMYVGL-DIGTTSVKVVVAEYI-----------DSQMNI
                                                        :.                             

sw|P49298|CISY_CITMA       LSNSVRW--LQMQSSADLDLHSQLKEMIPEQQERLKK--VKSDLGKAQ------------
sw|P32444|MBL_BACC1        ------------------GIVLNEPSVVAIDRNTG----KVLAVGEEA------------
sw|P39751|MBL_BACSU        ------------------GIVLNEPSVVALDKNSG----KVLAVGEEA------------
sw|P39763|MREBH_BACSU      ------------------GIILNEPSVVAVDTTTK----AVLAIGADA------------
sw|Q01465|MREB_BACSU       ------------------GIVVREPSVVALQTDTK----SIVAVGNDA------------
sw|P0A9X5|MREB_ECOL6       ------------------GIVLNEPSVVAIRQDRAGSPKSVAAVGHDA------------
sw|P0A9X4|MREB_ECOLI       ------------------GIVLNEPSVVAIRQDRAGSPKSVAAVGHDA------------
sw|P0A9X7|MREB_SALTI       ------------------GIVLNEPSVVAIRQDRAGSPKSVAAVGHDA------------
sw|P0A9X6|MREB_SALTY       ------------------GIVLNEPSVVAIRQDRAGSPKSVAAVGHDA------------
sw|P0A9X8|MREB_SHIFL       ------------------GIVLNEPSVVAIRQDRAGSPKSVAAVGHDA------------
sw|P44474|MREB_HAEIN       ------------------GIVLDEPSVVAIRQDRVGTLKSIAAVGKEA------------
sw|Q9L6A3|MREB_PASMU       ------------------GIVLDEPSVVAIRQERSGALKSIAAVGRDA------------
sw|Q8Y0L9|HSCA_RALSO       LPDE--------------QGRPLLPSVVRYLPA------GGAQIGYKA------------
sw|Q51382|HSCA_PSEAE       LPDA--------------QGRLILPSAVRYHAE-------RAEVGESA------------
sw|Q886Z7|HSCA_PSESM       LADA--------------EGQVILPSAVRYHAD-------RVEVGQAA------------
sw|Q7NAU6|DNAK_MYCGA       IENP--------------EGKRTTPSVVSYKN-------GEIIVGDAA------------
sw|P75344|DNAK_MYCPN       LENP--------------EGKRTTPSIVSYKNN-------EIIVGDAA------------
sw|Q9HHB9|DNAK_HALME       IVNA--------------EGDRTTPSVVAFTDD------GERLVGKPA------------
sw|Q8EPW4|DNAK_OCEIH       IPNP--------------EGNRTSPSVVAFKN-------GERQVGEVA------------
sw|Q9WYK6|DNAK_THEMA       IPNA--------------EGSRVTPSVVAFTKS------GEILVGEPA------------
sw|Q9ZAD3|DNAK_PORGI       ITNS--------------EGKRTTPSVVAFVDG------GERKVGDPA------------
sw|Q9XCB1|DNAK_RHOMR       IINP--------------EGSRVTPSVVAFTAD------GEPLVGAPA------------
sw|O07827|FTSA_PORGI       ISFY--E--EPANNCIRHGCVHNIDEAAAIIRRIVNQLNENLEDNTHI------------
sw|P0A331|FTSA_AGRT5       IGIG-----HQRSRGVKSGVIADLDALEGVIRLSVDA--AERMAGLTV------------
sw|P0A332|FTSA_AGRTU       IGIG-----HQRSRGVKSGVIADLDALEGVIRLSVDA--AERMAGLTV------------
sw|O30994|FTSA_RHIME       IGIG-----HQKSRGVKNGVIADLDAVESVVRLAVDA--AERMAGLTI------------
sw|Q9ZKM3|FTSA_HELPJ       IGTAHQDSKEINSKAIKRGRINSLAHASNAIKEVINS--AKKMAGLNADEDRNNPISSFR
sw|O25629|FTSA_HELPY       IGTAHQDSKEINSKAIKRGRINSLAHASNAIKEVINS--AKKMAGLNADEDRNNPMPHFG
sw|Q5HQ07|FTSA_STAEQ       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q8CPK5|FTSA_STAES       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|O07325|FTSA_STAAU       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q6GHQ0|FTSA_STAAR       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q6GA27|FTSA_STAAS       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q8NX33|FTSA_STAAW       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q5HGP6|FTSA_STAAC       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|P63764|FTSA_STAAM       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|P63765|FTSA_STAAN       IGTG-----QTYTSGIKNGLIDDFDIARQAIKDTIKK--ASIASGVDI------------
sw|Q44774|FTSA_BORBU       VGIG-----TSISRGVRKGVLINIEAALDSISNSIEA--AELISGCDI------------
sw|P47203|FTSA_PSEAE       VGIG-----THPSRGLKKGVVVNIESTVQSIQRAIDE--AQQMAGCRI------------
sw|P45068|FTSA_HAEIN       LGVG-----SCPSKGIDRGSITDLDAVVGSIQRAIEA--AESMADCQI------------
sw|P0ABH2|FTSA_ECO57       IGVG-----SCPSRGMDKGGVNDLESVVKCVQRAIDQ--AELMADCQI------------
sw|P0ABH1|FTSA_ECOL6       IGVG-----SCPSRGMDKGGVNDLESVVKCVQRAIDQ--AELMADCQI------------
sw|P0ABH0|FTSA_ECOLI       IGVG-----SCPSRGMDKGGVNDLESVVKCVQRAIDQ--AELMADCQI------------
sw|P0ABH3|FTSA_SHIFL       IGVG-----SCPSRGMDKGGVNDLESVVKCVQRAIDQ--AELMADCQI------------
sw|Q89AQ4|FTSA_BUCBP       IGIG-----LSKSIGIDRGIINDLKSIVECIKKVINQ--AETMANCNI------------
sw|P57309|FTSA_BUCAI       IGFG-----TCLSKGIDKGKINNLDLIVSCIQESINK--AEIMADCQI------------
sw|O51928|FTSA_BUCAP       IGIG-----ICQSNGIDKGRINNLDAVISCIRESIHQ--AEIMANCQI------------
sw|P28264|FTSA_BACSU       IGVG-----NVPSEGLKKGSIVDIDETVHSIRKAFDQ--AERMVGFPL------------
sw|O07111|FTSA_ENTFA       IGVG-----NAKSDGLNRGIVVDIDQTVQAIQRAVRQ--AEEKAGIQI------------
sw|O07672|FTSA_ENTHR       IGVG-----NAKSEGINRGIIVDIDKTVQAIQRAVRQ--AEEKAGIQI------------
                                                                       .               

sw|P49298|CISY_CITMA       -----LGNITIDVVIGGMRGMTGLLWETSLLDPDEGIRFRGLSIPECQKLLPAAKP----
sw|P32444|MBL_BACC1        ------RSMVGRTP-GNIVAIRPL------------------------------------
sw|P39751|MBL_BACSU        ------RRMVGRTP-GNIVAIRPL------------------------------------
sw|P39763|MREBH_BACSU      ------KNMIGKTP-GKIVAVRPM------------------------------------
sw|Q01465|MREB_BACSU       ------KNMIGRTP-GNVVALRPM------------------------------------
sw|P0A9X5|MREB_ECOL6       ------KQMLGRTP-GNIAAIRPM------------------------------------
sw|P0A9X4|MREB_ECOLI       ------KQMLGRTP-GNIAAIRPM------------------------------------
sw|P0A9X7|MREB_SALTI       ------KQMLGRTP-GNIAAIRPM------------------------------------
sw|P0A9X6|MREB_SALTY       ------KQMLGRTP-GNIAAIRPM------------------------------------
sw|P0A9X8|MREB_SHIFL       ------KQMLGRTP-GNIAAIRPM------------------------------------
sw|P44474|MREB_HAEIN       ------KLMLGRTP-KSIVAIRPM------------------------------------
sw|Q9L6A3|MREB_PASMU       ------KLMLGRTP-KSIAAIRPM------------------------------------
sw|Q8Y0L9|HSCA_RALSO       ------QVEAVRDPKNTIVSVKRFMGRGLKDV--AHIENTPYDFVDAPGMVQLKT-----
sw|Q51382|HSCA_PSEAE       ------RAAAAEDPFNTVISVKRLMGRG-LEDVKQLGEQLPYRFRQGESHMPFIET----
sw|Q886Z7|HSCA_PSESM       ------KAAASQDPFNTVLSVKRLMGR-GLSDVKQLGEQLPYRFVGGESHMPFIDT----
sw|Q7NAU6|DNAK_MYCGA       ------KRQMLTNP-NTIVSIKRLMGTSKKVKINDKG-----------------------
sw|P75344|DNAK_MYCPN       ------KRQMVTNP-NTIVSIKRLMGTSNKVTVKNPDG----------------------
sw|Q9HHB9|DNAK_HALME       ------KNQAIQNPEHTIRSIKRHMGDDGY----------------------TVDI----
sw|Q8EPW4|DNAK_OCEIH       ------KRQAITNP-NTIQSIKRHMGTDY-----------------------KVKI----
sw|Q9WYK6|DNAK_THEMA       ------KRQMILNPERTIKSIKRKMGTD-Y----------------------KVRI----
sw|Q9ZAD3|DNAK_PORGI       ------KRQAITNPTKTIYSIKRFMGET-YDQVSREVERVPFKVVRGDNNTPRVDI----
sw|Q9XCB1|DNAK_RHOMR       ------KRQAITNPKNTIFSIKRFMGR-FYDEVTEEISMVPYKVVRGENNTVRVEVEVGG
sw|O07827|FTSA_PORGI       ------TSLYVGVG-GQSIASQEFIVRKAMVPEGEVIRTEHIE-----SLWAEM------
sw|P0A331|FTSA_AGRT5       ------DSLIVNVSAGRLAS---DIYTASIDLGGQEVEASDLR-----KVLVAAS-----
sw|P0A332|FTSA_AGRTU       ------DSLIVNVSAGRLAS---DIYTASIDLGGQEVEASDLR-----KVLVAAS-----
sw|O30994|FTSA_RHIME       ------DSLIVNVSAGR---LQSDVYTATIDLGGQEVEANDLK-----KVLAAAG-----
sw|Q9ZKM3|FTSA_HELPJ       ESYHPKTKAIVSFSGAYTESIRDVTGVASTKD--NVVTIDEIN-----RAINNACA----
sw|O25629|FTSA_HELPY       E-YHPKTKAIVSFSGAYTESIRDVTGVASTKD--NVVTIDEIN-----RAINSACA----
sw|Q5HQ07|FTSA_STAEQ       ------KDVFLKLPIIGTEVYDESNEIEFYED--TEIDGTHIE-----SVLEGIR-----
sw|Q8CPK5|FTSA_STAES       ------KDVFLKLPIIGTEVYDESNEIEFYED--TEIDGTHIE-----SVLEGIR-----
sw|O07325|FTSA_STAAU       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|Q6GHQ0|FTSA_STAAR       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|Q6GA27|FTSA_STAAS       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|Q8NX33|FTSA_STAAW       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|Q5HGP6|FTSA_STAAC       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|P63764|FTSA_STAAM       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|P63765|FTSA_STAAN       ------KEVFLKLPIIGTEVYDESNEIDFYED--TEINGSHIE-----KVLEGIR-----
sw|Q44774|FTSA_BORBU       ------TSLSVSMS-GSSVEGTNSRGVVAINSKTREINEEDVE-----RVIEAAK-----
sw|P47203|FTSA_PSEAE       ------HSAFVGIAGNHIRSLNSH-GIVAIRD--REVNPADIE-----RVLDAAQ-----
sw|P45068|FTSA_HAEIN       ------MSVTLAITGEHIQSLNES-GFVPIAE--SEVTQEEID-----SALHTAS-----
sw|P0ABH2|FTSA_ECO57       ------SSVYLALS-GKHISCQNEIGMVPISE--EEVTQEDVE-----NVVHTAK-----
sw|P0ABH1|FTSA_ECOL6       ------SSVYLALS-GKHISCQNEIGMVPISE--EEVTQEDVE-----NVVHTAK-----
sw|P0ABH0|FTSA_ECOLI       ------SSVYLALS-GKHISCQNEIGMVPISE--EEVTQEDVE-----NVVHTAK-----
sw|P0ABH3|FTSA_SHIFL       ------SSVYLALS-GKHISCQNEIGMVPISE--EEVTQEDVE-----NVVHTAK-----
sw|Q89AQ4|FTSA_BUCBP       ------TSIYLALS-NKYINCQNEIGIIPILQ--EEITKNDIE-----NVIHTAK-----
sw|P57309|FTSA_BUCAI       ------TSVYLSLS-NKYINCQNEIGIIPISD--DEVTKEDIE-----HVIHIAQ-----
sw|O51928|FTSA_BUCAP       ------TSVYLSLS-SKYINCQNEIGIVPISE--DEVTKEDIE-----NVIHTAK-----
sw|P28264|FTSA_BACSU       ------RKAIVGVN-GNYINIQDTNGVVAVSSENKEIQVEDVR-----RVMAAAQ-----
sw|O07111|FTSA_ENTFA       ------KSVNVGLP-ANLLEVESCQGMIAVSSESKEITDEDVR-----NVASAAL-----
sw|O07672|FTSA_ENTHR       ------KGVSVGLP-ANLLEVENCQGMIAVNGDSKEITDEDVR-----NVASAAL-----
                                                                                       

sw|P49298|CISY_CITMA       DGEPLPEGLLWLLLTGKVPSKEQVDGLSKELRDRATVPD--YVYKAIDALPVSAHPMTQF
sw|P32444|MBL_BACC1        KDGVIAD----FEITEAMLKYFI-----NKLDVKSFFSK----PRILICCPTNITSVEQK
sw|P39751|MBL_BACSU        KDGVIAD----FEVTEAMLKHFI-----NKLNVKGLFSK----PRMLICCPTNITSVEQK
sw|P39763|MREBH_BACSU      KDGVIAD----YDMTTDLLKH-------IMKKAAKSIGMSFRKPNVVVCTPSGSTAVERR
sw|Q01465|MREB_BACSU       KDGVIAD----YETTATMMKYYIN----QAIKNKGMFTR--K-PYVMVCVPSGITAVEER
sw|P0A9X5|MREB_ECOL6       KDGVIAD----FFVTEKMLQHF------IKQVHSNSFMR--PSPRVLVCVPVGATQVERR
sw|P0A9X4|MREB_ECOLI       KDGVIAD----FFVTEKMLQHF------IKQVHSNSFMR--PSPRVLVCVPVGATQVERR
sw|P0A9X7|MREB_SALTI       KDGVIAD----FFVTEKMLQHF------IKQVHSNSFMR--PSPRVLVCVPVGATQVERR
sw|P0A9X6|MREB_SALTY       KDGVIAD----FFVTEKMLQHF------IKQVHSNSFMR--PSPRVLVCVPVGATQVERR
sw|P0A9X8|MREB_SHIFL       KDGVIAD----FFVTEKMLQHF------IKQVHSNSFMR--PSPRVLVCVPVGATQVERR
sw|P44474|MREB_HAEIN       KDGVIAD----FFVTEKMLQYF------IKQVHSGNFMR--PSPRVLVCVPAGATQVERR
sw|Q9L6A3|MREB_PASMU       KDGVIAD----FFVTEKMLQYF------IKQVHSSNFMR--PSPRVLVCVPAGATQVERR
sw|Q8Y0L9|HSCA_RALSO       VAGVKSP----VEVSAEILAT-------LRQRAEDTLGD--DLVGAVITVPAYFDDAQRQ
sw|Q51382|HSCA_PSEAE       VQGLKSP----VEVSADILRE-------LRQRAETTLGG--ELVGAVITVPAYFDDAQRQ
sw|Q886Z7|HSCA_PSESM       VQGAKSP----VEVSADILKV-------LRQRAEAALGG--ELVGAVITVPAYFDDSQRQ
sw|Q7NAU6|DNAK_MYCGA       VEKELTP----EEVSASILSY-------LKDYAEKKTGQ--KISRAVITVPAYFNDAERQ
sw|P75344|DNAK_MYCPN       STKELTP----EEVSAQILSY-------LKDYAEKKIGK--TISRAVITVPAYFNDAERN
sw|Q9HHB9|DNAK_HALME       EGEEYTP----EQISAMILQK-------IKRDAEDYLGD--EVEKAVITVPAYFNDKQRQ
sw|Q8EPW4|DNAK_OCEIH       EEKEYTP----QEVSAIILQY-------IKSYAEDYIGE--KVEKAVITVPAYFNDAERQ
sw|Q9WYK6|DNAK_THEMA       DDKEYTP----QEISAFILKK-------LKNDAEAYLGG--EIKKAVITCPAYFNDAQRQ
sw|Q9ZAD3|DNAK_PORGI       DGRLYTP----QEISAMILQK-------MKKTAEDYLGQ--EVTEAVITVPAYFNDAQRQ
sw|Q9XCB1|DNAK_RHOMR       EKRLYTP----QEISAMILQK-------LKQTAEEYLGV--PVTEAVITVPAYFNDAQRK
sw|O07827|FTSA_PORGI       RGASFPD----KEVLDVTDPLFYVDGK-QEIQAKGVFC---HELEARFQLITARRSVKQN
sw|P0A331|FTSA_AGRT5       QQSMRQD----RAILHSLPTGYSLDGERGIRDPLSMYGD---LLGVDMHVVTVERTALKN
sw|P0A332|FTSA_AGRTU       QQSMRQD----RAILHSLPTGYSLDGERGIRDPLSMYGD---LLGVDMHVVTVERTALKN
sw|O30994|FTSA_RHIME       HQSLRTD----RAILHSLPTGFSLDGERGIRDPLAMFGD---VLGVDMHVLTAERPALKN
sw|Q9ZKM3|FTSA_HELPJ       KAGLDND----KHILHALPYRFTLDKQE-VNDPLGMSGT--R-LEVFIHIVYTEKNNIEN
sw|O25629|FTSA_HELPY       KAGLDND----KHILHALPYRFTLDKQE-VNDPLGMSGT--R-LEVFIHIVYTEKNNIEN
sw|Q5HQ07|FTSA_STAEQ       DKNDVPE----TEVINVFPIRFVVDKDNEVSDPKELIAR--HSLKVDAGVIAIQKSILIN
sw|Q8CPK5|FTSA_STAES       DKNDVPE----TEVINVFPIRFVVDKDNEVSDPKELIAR--HSLKVDAGVIAIQKSILIN
sw|O07325|FTSA_STAAU       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|Q6GHQ0|FTSA_STAAR       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|Q6GA27|FTSA_STAAS       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|Q8NX33|FTSA_STAAW       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|Q5HGP6|FTSA_STAAC       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|P63764|FTSA_STAAM       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|P63765|FTSA_STAAN       EKNDVQE----TEVINVFPIRFIVDKENEVSDPKELIAR--HSLKVEAGVIAIQKSILIN
sw|Q44774|FTSA_BORBU       AIVIPMD----REILHVIPQEFIVDGIPHIKNPIDMMGI---RLEGEVHIITGSSSSSQN
sw|P47203|FTSA_PSEAE       AVAIPAD----QRVLHTLAQDYVIDNQEGVREPLGMSGV--R-LEAKVHVVTCAVNASQN
sw|P45068|FTSA_HAEIN       SIKLPEG----LSLLHVIPQEYAVDRQMNIKNPLGLQGV--R-LKAQVHLIACHQDWQNN
sw|P0ABH2|FTSA_ECO57       SVRVRDE----HRVLHVIPQEYAIDYQEGIKNPVGLSGV--R-MQAKVHLITCHNDMAKN
sw|P0ABH1|FTSA_ECOL6       SVRVRDE----HRVLHVIPQEYAIDYQEGIKNPVGLSGV---RMQAKVHLITCHNDMAKN
sw|P0ABH0|FTSA_ECOLI       SVRVRDE----HRVLHVIPQEYAIDYQEGIKNPVGLSGV---RMQAKVHLITCHNDMAKN
sw|P0ABH3|FTSA_SHIFL       SVRVRDE----HRVLHVIPQEYAIDYQEGIKNPVGLSGV--R-MQAKVHLITCHNDMAKN
sw|Q89AQ4|FTSA_BUCBP       SVRIRNE----HKILHIIPQEYSIDERTGIKNPIGLSGI--R-MQAIVHLITCHSSIKKN
sw|P57309|FTSA_BUCAI       SVQILNE----HHILHVIPQEYSIDQQYGIKNPIGLSGV--R-MQVKVHLITCHQNMARN
sw|O51928|FTSA_BUCAP       SVKILNE----HHILHVIPQEYSIDQQSGIKNPIGLSGT--R-MQVRVHLITCHQNMAKN
sw|P28264|FTSA_BACSU       VVSVPHE----QLIVDVIPKQFIVDGRDEITDPKKMLGV--R-LEVEGTLITGSKTILHN
sw|O07111|FTSA_ENTFA       VRSTPPE----RQIVAILPQDFTVDGFEGIKDPRGMLGV--R-MEMFGVVYTGPKTIIHN
sw|O07672|FTSA_ENTHR       VRSIPPE----RQIVSILPQDFTVDGFEGIKDPRGMIGV--R-LEMYGLLFTGPKTIVHN
                                                                                       

sw|P49298|CISY_CITMA       ASGVMALQVQSEFQEAYEKGIHKSKSWEPTSEDSLNLIARVPVVAAYVYQRIYKDGK---
sw|P32444|MBL_BACC1        AIREAAERSGGKTVFLEEEPKVAAVGAGMEIFQ-PSGNMVVDIGGGTTDIAVLSMGD---
sw|P39751|MBL_BACSU        AIKEAAEKSGGKHVYLEEEPKVAAIGAGMEIFQ-PSGNMVVDIGGGTTDIAVISMGD---
sw|P39763|MREBH_BACSU      AISDAVKNCGAKNVHLIEEPVAAAIGADLPVDE-PVANVVVDIGGGTTEVAIISFGG---
sw|Q01465|MREB_BACSU       AVIDATRQAGARDAYPIEEPFAAAIGANLPVWE-PTGSMVVDIGGGTTEVAIISLGG---
sw|P0A9X5|MREB_ECOL6       AIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE-ATGSMVVDIGGGTTEVAVISLNG---
sw|P0A9X4|MREB_ECOLI       AIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE-ATGSMVVDIGGGTTEVAVISLNG---
sw|P0A9X7|MREB_SALTI       AIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE-ATGSMVVDIGGGTTEVAVISLNG---
sw|P0A9X6|MREB_SALTY       AIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE-ATGSMVVDIGGGTTEVAVISLNG---
sw|P0A9X8|MREB_SHIFL       AIRESAQGAGAREVFLIEEPMAAAIGAGLPVSE-ATGSMVVDIGGGTTEVAVISLNG---
sw|P44474|MREB_HAEIN       AIKESAIGAGAREVYLIEEPMAAAIGAKLPVST-AVGSMVIDIGGGTTEVAVISLNG---
sw|Q9L6A3|MREB_PASMU       AIKESAIGAGAREVYLIEEPMAAAIGAKLPVST-ATGSMVIDIGGGTTEVAVISLNG---
sw|Q8Y0L9|HSCA_RALSO       ATKDAARLAGLNVLRLLNEPTAAAIAYGLDNAA-EGVYAVYDLGGGTFDISVLKLTKGVF
sw|Q51382|HSCA_PSEAE       ATKDAARLAGLNVLRLLNEPTAAAVAYGLDKGA-EGLVAIYDLGGGTFDISILRLTRGVF
sw|Q886Z7|HSCA_PSESM       ATKDAAKLAGLNVLRLLNEPTAAAVAYGLDQKA-EGVIAIYDLGGGTFDISILRLTGGVF
sw|Q7NAU6|DNAK_MYCGA       ATKTAGKIAGLTVERIINEPTAAALAYGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTF
sw|P75344|DNAK_MYCPN       ATKTAGKIAGLNVERIINEPTAAALAYGIDKSNREMKVLVYDLGGGTFDVSLLDIAEGTF
sw|Q9HHB9|DNAK_HALME       ATKDAGEIAGLEVERIVNEPTAASMAYGLDDES-NQTVLVYDLGGGTFDVSVLDLGGGVY
sw|Q8EPW4|DNAK_OCEIH       ATKDAGKIAGLEVERIINEPTAAALAYGIDKEDQDQTILVYDLGGGTFDVSILDIGDGTF
sw|Q9WYK6|DNAK_THEMA       ATKEAGIIAGLEVLRIINEPTAAALAYGLDKAGKEEKVLVYDLGGGTFDVSILEIGEGVI
sw|Q9ZAD3|DNAK_PORGI       ATKEAGEIAGLKVRRIVNEPTAASLAYGLDKSNKDMKIAVFDLGGGTFDISILELGDGVF
sw|Q9XCB1|DNAK_RHOMR       ATKEAGEIAGLKVRRILNEPTAAALAYGLDKKDKELKIAVYDLGGGTYDISILELGDGVF
sw|O07827|FTSA_PORGI       IRIAIEERLGLRLTGILVTPLCEAQVL-LSDDELTLGCCYVNIGAGCTSVSIYKNRL---
sw|P0A331|FTSA_AGRT5       LEL-CVNRAHLSVEGMVATPYASGLAA-LVDDEVELGCAAIDMGGGTTTISVFAEGR---
sw|P0A332|FTSA_AGRTU       LEL-CVNRAHLSVEGMVATPYASGLAA-LVDDEVELGCAAIDMGGGTTTISVFAEGR---
sw|O30994|FTSA_RHIME       LEL-CVNRAHLSVEGMVATPYASGLAA-LVDDEVELGCAAIDMGGGTTTISVFAEGK---
sw|Q9ZKM3|FTSA_HELPJ       LEK-IMIQSGVEIENIVINSYAASIAT-LSNDERELGVACVDMGGETCNLTIYSGNS---
sw|O25629|FTSA_HELPY       LEK-IMIQSGVEIENIVINSYAASIAT-LSNDERELGVACVDMGGETCNLTIYSGNS---
sw|Q5HQ07|FTSA_STAEQ       MIK-CVEACGVDVLDVYSDAY--NYGSILTPTEKELGACVIDIGEDLTQVAFYERGE---
sw|Q8CPK5|FTSA_STAES       MIK-CVEACGVDVLDVYSDAY--NYGFILTPTEKELGACVIDIGEDLTQVAFYERGE---
sw|O07325|FTSA_STAAU       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|Q6GHQ0|FTSA_STAAR       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|Q6GA27|FTSA_STAAS       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|Q8NX33|FTSA_STAAW       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|Q5HGP6|FTSA_STAAC       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|P63764|FTSA_STAAM       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|P63765|FTSA_STAAN       MIK-CVEACGVDVLDVYSDAY--NYGSILTATEKELGACVIDIGEDVTQVAFYERGE---
sw|Q44774|FTSA_BORBU       LVR-CVNRAGFAVDEVVLGSLASSYAT-LSKEEREMGVLFIDMGKGTTDIILYIDGS---
sw|P47203|FTSA_PSEAE       IEK-CVRRCGLEVDDIILEQLASAYSV-LTEDEKELGVCLVDIGGGTTDIAIFTEGA---
sw|P45068|FTSA_HAEIN       LKK-AVERCGLQVDKVVFSGFAATHSV-LTEDEKDLGVCLIDFGAGTMNVMVYTNGA---
sw|P0ABH2|FTSA_ECO57       IVK-AVERCGLKVDQLIFAGLASSYSV-LTEDERELGVCVVDIGGGTMDIAVYTGGA---
sw|P0ABH1|FTSA_ECOL6       IVK-AVERCGLKVDQLIFAGLASSYSV-LTEDERELGVCVVDIGGGTMDIAVYTGGA---
sw|P0ABH0|FTSA_ECOLI       IVK-AVERCGLKVDQLIFAGLASSYSV-LTEDERELGVCVVDIGGGTMDIAVYTGGA---
sw|P0ABH3|FTSA_SHIFL       IVK-AVERCGLKVDQLIFAGLASSYSV-LTEDERELGVCVVDIGGGTMDIAVYTGGA---
sw|Q89AQ4|FTSA_BUCBP       IIK-AVESCGIRVDYSVFSGLASSESV-LTTDERNLGVCIVDIGGGTTDIAIYTNGT---
sw|P57309|FTSA_BUCAI       IIK-AVEKCDVKVDQVIFSGLASSKAV-LTEDECNLGVCMIDIGGGTIDFTIYIDGS---
sw|O51928|FTSA_BUCAP       IIK-AVEKCDIKVDQVIFSGLASSKAV-LTEDECKLGVCMIDIGGGTIDLITYIDGS---
sw|P28264|FTSA_BACSU       LLR-CVERAGIEITDICLQPLAAGSAA-LSKDEKNLGVALIDIGGGSTTIAVFQNGH---
sw|O07111|FTSA_ENTFA       IRK-CVEKAGLGINELVITPLALTETI-LTDGEKDFGTIVIDMGGGQTTTSVIHDKQ---
sw|O07672|FTSA_ENTHR       IRK-CVENAGLVVNELVITPLALTETI-LSDGEKDFGTIVIDMGGGQTTTAVMHDKQ---
                                                                     .                 

sw|P49298|CISY_CITMA       -IIPKDDSLDYGGNFSHMLGFDDPKMLELMRLY-----VT--------------------
sw|P32444|MBL_BACC1        --IVTSSSIKMAGD-----KFDMEILNYIKRKY-----KL--------------------
sw|P39751|MBL_BACSU        --IVTSSSIKMAGD-----KFDMEILNYIKREY-----KL--------------------
sw|P39763|MREBH_BACSU      --VVSCHSIRIGGD-----QLDEDIVSFVRKKY-----NL--------------------
sw|Q01465|MREB_BACSU       --IVTSQSIRVAGD-----EMDDAIINYIRKTY-----NL--------------------
sw|P0A9X5|MREB_ECOL6       --VVYSSSVRIGGD-----RFDEAIINYVRRNY-----GS--------------------
sw|P0A9X4|MREB_ECOLI       --VVYSSSVRIGGD-----RFDEAIINYVRRNY-----GS--------------------
sw|P0A9X7|MREB_SALTI       --VVYSSSVRIGGD-----RFDEAIINYVRRNY-----GS--------------------
sw|P0A9X6|MREB_SALTY       --VVYSSSVRIGGD-----RFDEAIINYVRRNY-----GS--------------------
sw|P0A9X8|MREB_SHIFL       --VVYSSSVRIGGD-----RFDEAIINYVRRNY-----GS--------------------
sw|P44474|MREB_HAEIN       --IVYSSSVRIGGD-----RFDEAIISYVRRTF-----GS--------------------
sw|Q9L6A3|MREB_PASMU       --IVYSSSVRIGGD-----RFDEAIISYVRKTF-----GS--------------------
sw|Q8Y0L9|HSCA_RALSO       EVMSTGGDSALGGD-----DFDQRIACWIVEQA-----GLQP-LSAEDMRLLLNKARAAK
sw|Q51382|HSCA_PSEAE       EVLATGGDTALGGD-----DFDHAIAGWVIEQA-----GLSADLDPGSQRQLLQIACAAK
sw|Q886Z7|HSCA_PSESM       EVLATGGDTALGGD-----DFDHAIASWIVADA-----GLSADLDPSAQRSLLQAACSAK
sw|Q7NAU6|DNAK_MYCGA       EVMATAGDNRLGGD-----DWDNKIIEWIIAEIKKDHPSLDLKSDKMAMQRLKEAAERAK
sw|P75344|DNAK_MYCPN       EVLATAGDNRLGGD-----DWDNKIIEFILAHIAQEHNGLNLSNDKMAMQRLKEAAERAK
sw|Q9HHB9|DNAK_HALME       EVVATNGDNELGGD-----DWDEAIIDWLATEFKNDH-GIDLREDRQALQRLKDAAEEAK
sw|Q8EPW4|DNAK_OCEIH       EVVSTAGDNRLGGD-----DFDQVIIDHMVQEFKKEN-AIDLSQDKMATQRLKDAAEKAK
sw|Q9WYK6|DNAK_THEMA       EVIATAGNNHLGGD-----DFDQRLIDWMAEEFKKQH-GIDLREDRQALQRLRDAAEKAK
sw|Q9ZAD3|DNAK_PORGI       EVKSTNGDTHLGGD-----DFDHVIIDWLAEEFKSQE-GVDLRQDPMAMQRLKEAAEKAK
sw|Q9XCB1|DNAK_RHOMR       EVKATNGDTHLGGD-----NFDQRLIDYIADEFQKQE-GIDLRKDPMALQRLKEAAEKAK
sw|O07827|FTSA_PORGI       --LAMLRVLPMGGY-----NVTRDLT------------SL--------------------
sw|P0A331|FTSA_AGRT5       --LIHTDAIGLGGH-----HVTTDLAR-----------GL--------------------
sw|P0A332|FTSA_AGRTU       --LIHTDAIGLGGH-----HVTTDLAR-----------GL--------------------
sw|O30994|FTSA_RHIME       --LVHADAVGLGGH-----HVTTDLAR-----------GL--------------------
sw|Q9ZKM3|FTSA_HELPJ       --IRYNKYLPVGSH-----HLTTDLSH-----------ML--------------------
sw|O25629|FTSA_HELPY       --IRYNKYLPVGSH-----HLTTDLSH-----------ML--------------------
sw|Q5HQ07|FTSA_STAEQ       --LVDAESIEMAGR-----DITDDIAQ-----------GL--------------------
sw|Q8CPK5|FTSA_STAES       --LVDAESIEMAGR-----DITDDIAQ-----------GL--------------------
sw|O07325|FTSA_STAAU       --LVDADSIEMAGR-----DITRRYCTRIK--------AL--------------------
sw|Q6GHQ0|FTSA_STAAR       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|Q6GA27|FTSA_STAAS       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|Q8NX33|FTSA_STAAW       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|Q5HGP6|FTSA_STAAC       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|P63764|FTSA_STAAM       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|P63765|FTSA_STAAN       --LVDADSIEMAGR-----DITDDIAQ-----------GL--------------------
sw|Q44774|FTSA_BORBU       --PYYTGVIPIGVN-----RVTLDIAQ-----------VW--------------------
sw|P47203|FTSA_PSEAE       --IRHTAVIPIAGD-----QVTNDIAM-----------AL--------------------
sw|P45068|FTSA_HAEIN       --LRFSKVIPYAGN-----IVTNDIAH-----------AC--------------------
sw|P0ABH2|FTSA_ECO57       --LRHTKVIPYAGN-----VVTSDIAY-----------AF--------------------
sw|P0ABH1|FTSA_ECOL6       --LRHTKVIPYAGN-----VVTSDIAY-----------AF--------------------
sw|P0ABH0|FTSA_ECOLI       --LRHTKVIPYAGN-----VVTSDIAY-----------AF--------------------
sw|P0ABH3|FTSA_SHIFL       --LRHTKVIPYAGN-----VVTSDIAY-----------AF--------------------
sw|Q89AQ4|FTSA_BUCBP       --LKHSCVIPYAGN-----TVTNDISY-----------VF--------------------
sw|P57309|FTSA_BUCAI       --IKYSQVIPYAGN-----IVTSDISY-----------AF--------------------
sw|O51928|FTSA_BUCAP       --IQDSQVIPYAGN-----IVTKDISY-----------AF--------------------
sw|P28264|FTSA_BACSU       --LTSTRVIPLGGE-----NITKDISI-----------GL--------------------
sw|O07111|FTSA_ENTFA       --LKFTHVNQEGGE-----FITKDISI-----------VL--------------------
sw|O07672|FTSA_ENTHR       --LKFTSLDQEGGE-----FVTKDISI-----------VL--------------------
                                      .                                                

sw|P49298|CISY_CITMA       -----------------IHSDHEGGNVSA-----HTGH-LVA--SALSDPYLSFLAALNG
sw|P32444|MBL_BACC1        -----------------LIGERTSEDIKI-----KVGT-VFP--GARSEELEIRGRDMVT
sw|P39751|MBL_BACSU        -----------------LIGERTAEDIKI-----KVAT-VFP--DARHEEISIRGRDMVS
sw|P39763|MREBH_BACSU      -----------------LIGERTAEQVKM-----EIGH-ALI--EHIPEAMEIRGRDLVT
sw|Q01465|MREB_BACSU       -----------------MIGDRTAEAIKM-----EIGS-AEA--PEESDNMEIRGRDLLT
sw|P0A9X5|MREB_ECOL6       -----------------LIGEATAERIKH-----EIGS-AYP--GDEVREIEVRGRNLAE
sw|P0A9X4|MREB_ECOLI       -----------------LIGEATAERIKH-----EIGS-AYP--GDEVREIEVRGRNLAE
sw|P0A9X7|MREB_SALTI       -----------------LIGEATAERIKH-----EIGS-AYP--GDEVREIEVRGRNLAE
sw|P0A9X6|MREB_SALTY       -----------------LIGEATAERIKH-----EIGS-AYP--GDEVREIEVRGRNLAE
sw|P0A9X8|MREB_SHIFL       -----------------LIGEATAERIKH-----EIGS-AYP--GDEVREIEVRGRNLAE
sw|P44474|MREB_HAEIN       -----------------VIGEPTAERIKQ-----EIGS-AYIQEGDEIKEMEVHGHNLAE
sw|Q9L6A3|MREB_PASMU       -----------------IIGEPTAERIKQ-----EIGS-AFIQEGDEVREIEVHGHNLAE
sw|Q8Y0L9|HSCA_RALSO       EWLSGADSTEV------DAVLSTGETVHL-----VLTA-ETF--AELTANLVQKTLAPVR
sw|Q51382|HSCA_PSEAE       E----------------RLTDEASVRVAYGDWSGELSR-ATL--DELIEPFVARSLKSCR
sw|Q886Z7|HSCA_PSESM       EALTDA-----------EFVEVTHGEWRG-----TLTR-DAL--NALIEPMIARSLKACR
sw|Q7NAU6|DNAK_MYCGA       IELSAQLETLISLPFI-AVTPEGPVNAEL-----TLSR-AKF--EELTKDLLERTRNPIA
sw|P75344|DNAK_MYCPN       IELSAQLEAIISLPFL-TVTEKGPVNVEL-----KLTR-AKF--EEITKQLLERTRNPIS
sw|Q9HHB9|DNAK_HALME       IELSSRKETTINLPFI-TATDSGPVHLEY-----DLTR-AKF--ESLTKDLIDRTVEPTE
sw|Q8EPW4|DNAK_OCEIH       KDLSGVTQTQISLPFI-TAGDAGPLHLEM-----TMSR-AKF--DELSSDLVERTMQPTR
sw|Q9WYK6|DNAK_THEMA       IELSTKMETDVSLPFIAVSPSGQPLHLEM-----RITR-SLF--ESLTRDLVEMTRGPIE
sw|Q9ZAD3|DNAK_PORGI       IELSSTSSTEINLPYI-MPVNGIPKHLVM-----TLTR-AKF--EQLADRLIQACVAPCE
sw|Q9XCB1|DNAK_RHOMR       IELSSAMKTTVNLPFI-TATAEGPKHLVM-----EITR-AKF--EQLIEDLVARTIPPME
sw|O07827|FTSA_PORGI       -----------------RLTEQEAENMKL-----NHVS-MIN--DNKSNGSFRMTFA---
sw|P0A331|FTSA_AGRT5       -----------------STRIEDAERLKV-----VHGS-ALL--NG-ADERDMISIPPIG
sw|P0A332|FTSA_AGRTU       -----------------STRIEDAERLKV-----VHGS-ALL---NGADERDMISIPPIG
sw|O30994|FTSA_RHIME       -----------------STRIEDAERLKV-----VHGS-ALP--NS-ADERDIISVPPIG
sw|Q9ZKM3|FTSA_HELPJ       -----------------NTPFPYAEEVKI-----KYGDLSFE--SGAETPSQSVQIPTTG
sw|O25629|FTSA_HELPY       -----------------NTPFPYAEEVKI-----KYGDLSFE--GGEETPSQNVQIPTTG
sw|Q5HQ07|FTSA_STAEQ       -----------------NTTYDTAEKVKH-----QYGH-AFY--DS-ASDQDVFSVDQVD
sw|Q8CPK5|FTSA_STAES       -----------------NTTYDTAEKVKH-----QYGH-AFY--DS-ASDQDVFSVDQVD
sw|O07325|FTSA_STAAU       -----------------LMKLLKKLNTNM-----VMHSMILL--QIKISSLLNRLI----
sw|Q6GHQ0|FTSA_STAAR       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|Q6GA27|FTSA_STAAS       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|Q8NX33|FTSA_STAAW       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|Q5HGP6|FTSA_STAAC       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|P63764|FTSA_STAAM       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|P63765|FTSA_STAAN       -----------------NTSYETAEKVKH-----QYGH-AFY--DS-ASDQDIFTVEQVD
sw|Q44774|FTSA_BORBU       -----------------KVPEDVAENIKI-----TAGI-AHP--SILESQMETVIIPNLG
sw|P47203|FTSA_PSEAE       -----------------RTPTQYAEEIKI-----RYAC-AL---AKLAGAGETIKVPSVG
sw|P45068|FTSA_HAEIN       -----------------TISRAEAERIKV-----NYAS-AFY--PARLHGDKKIEVASIG
sw|P0ABH2|FTSA_ECO57       -----------------GTPPSDAEAIKV-----RHGC-AL---GSIVGKDESVEVPSVG
sw|P0ABH1|FTSA_ECOL6       -----------------GTPPSDAEAIKV-----RHGC-AL---GSIVGKDESVEVPSVG
sw|P0ABH0|FTSA_ECOLI       -----------------GTPPSDAEAIKV-----RHGC-AL---GSIVGKDESVEVPSVG
sw|P0ABH3|FTSA_SHIFL       -----------------GTPPSDAEAIKV-----RHGC-AL---GSIVGKDESVEVPSVG
sw|Q89AQ4|FTSA_BUCBP       -----------------NIPFMYAEKIKI-----KYGY-AMQ--SSDITEEEIKIVNEDN
sw|P57309|FTSA_BUCAI       -----------------STSRDNAENIKI-----KYGS-VKK--PP-LGSSKNIDFSDIN
sw|O51928|FTSA_BUCAP       -----------------STSYSDSEKIKI-----KYGS-AIK--LS-PGTSKNIDLSSKY
sw|P28264|FTSA_BACSU       -----------------RTSTEEAERVKK-----QLGH-AYY---DEASEDEIFEVTVIG
sw|O07111|FTSA_ENTFA       -----------------NTSFNNAEALKI-----NYGD-AYP---ERTSANEEFPVDVIG
sw|O07672|FTSA_ENTHR       -----------------NTSFNNAEALKI-----NYGD-AYP---ERTSANEEFPVDVIG
                                                                                       

sw|P49298|CISY_CITMA       LAGPL--HGLANQEVLLWIKSVVDECGEN----------VTTEQLKDYVWKTLNSGKVVP
sw|P32444|MBL_BACC1        GLPRT--ITVCSEEITEALKENAAVIVQAAKGVLE----RTPPELSADIIDR---GVILT
sw|P39751|MBL_BACSU        GLPRT--ITVNSKEVEEALRESVAVIVQAAKQVLE----RTPPELSADIIDR---GVIIT
sw|P39763|MREBH_BACSU      GLPKT--IMLQSNEIQDAMRESLLHILEAIRATLE----DCPPELSGDIVDR---GVILT
sw|Q01465|MREB_BACSU       GLPKT--IEITGKEISNALRDTVSTIVEAVKSTLE----KTPPELAADIMDR---GIVLT
sw|P0A9X5|MREB_ECOL6       GVPRG--FTLNSNEILEALQEPLTGIVSAVMVALE----QCPPELASDISER---GMVLT
sw|P0A9X4|MREB_ECOLI       GVPRG--FTLNSNEILEALQEPLTGIVSAVMVALE----QCPPELASDISER---GMVLT
sw|P0A9X7|MREB_SALTI       GVPRG--FTLNSNEILEALQEPLTGIVSAVMVALE----QCPPELASDISER---GMVLT
sw|P0A9X6|MREB_SALTY       GVPRG--FTLNSNEILEALQEPLTGIVSAVMVALE----QCPPELASDISER---GMVLT
sw|P0A9X8|MREB_SHIFL       GVPRG--FTLNSNEILEALQEPLTGIVSAVMVALE----QCPPELASDISER---GMVLT
sw|P44474|MREB_HAEIN       GAPRS--FTLTSRDVLEAIQQPLNGIVAAVRTALE----ECQPEHAADIFER---GMVLT
sw|Q9L6A3|MREB_PASMU       GAPRS--FKLTSRDVLEAIQAPLNGIVAAVRTALE----ECQPEHAADIFER---GMVLT
sw|Q8Y0L9|HSCA_RALSO       RALRD--AGVAVDEIQGVVLVGGATRMPVIRRAVAQLF-GRAPLTNLDPDQVVAIGAAMQ
sw|Q51382|HSCA_PSEAE       RAVRD--SGVDLEEIRSVVMVGGSTRVPRVRTAVGELF-GCEPLTDIDPDQVVAIGAAIQ
sw|Q886Z7|HSCA_PSESM       RAVRD--TGIELEEVEAVVMVGGSTRVPRVREAVAELF-GRQPLTQIDPDQVVAIGAAIQ
sw|Q7NAU6|DNAK_MYCGA       DVLKE--AKVDPSQVDEILLVGGSTRMPAVQKLVESMIPNKAPNRTINPDEVVAIGAAVQ
sw|P75344|DNAK_MYCPN       DVLRE--AKIKPEEINEILLVGGSTRMPAVQKLVESMVPGHSPNRSINPDEVVAIGAAIQ
sw|Q9HHB9|DNAK_HALME       QALED--AGYGKDDIDDVILVGGSTRMPQVLDKVEEIL-GSEPKKSVNPDEAVALGAAIQ
sw|Q8EPW4|DNAK_OCEIH       KALSD--ASLSKSDIDKVILVGGSTRIPAVQEAIKKEL-GQDPSKGVNPDEVVALGAAIQ
sw|Q9WYK6|DNAK_THEMA       QALND--AKLSPQDIDEIILVGGMTRVPMVQRFIKEFF-GKEPNKSVNPDEAVAIGAAIQ
sw|Q9ZAD3|DNAK_PORGI       TALKD--AGMSRGDIDEVILVGGSTRIPAIQEIVEKIF-GKAPSKGVNPDEVVAVGAAIQ
sw|Q9XCB1|DNAK_RHOMR       QALKD--AKLRKEDIDEVILVGGSTRIPLVQRTVEEFF-GKKANKSVNPDEVVAIGAAIQ
sw|O07827|FTSA_PORGI       DKFSE--REFRSSEVNRLAKARMDEITANYLNILR----------LSGLLEDIGAGIILN
sw|P0A331|FTSA_AGRT5       EDDRDQPSQVSRALVTRIVRARIEETLELIRDRIQ----------KSGFSPIVGKRVVLT
sw|P0A332|FTSA_AGRTU       EDDRDQPSQVSRALVTRIVRARIEETLELIRDRIQ----------KSGFSPIVGKRVVLT
sw|O30994|FTSA_RHIME       EDDRDQPTHVPRALVSRIVRARIEETLELIRDRIQ----------RSGFSPIVGKRIVLT
sw|Q9ZKM3|FTSA_HELPJ       SDGHE-SHIVPLSEIQTIMRERALETFKIIHRSIQ----------DSGFEEHLGGGVVLT
sw|O25629|FTSA_HELPY       SDGHE-SHIVPLSEIQTIMRERALETFKIIHRSIQ----------DSGLEEHLGGGVVLT
sw|Q5HQ07|FTSA_STAEQ       SDEHV---QYTQKDLSDFIEQRVEDIFFEVFDVLQ----------ELGLT-KVNGGFVVT
sw|Q8CPK5|FTSA_STAES       SDEHV---QYTQKDLSDFIEQRVEDIFFEVFDVLQ----------ELGLT-KVNGGFVVT
sw|O07325|FTSA_STAAU       -VMKQ--YSIPQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|Q6GHQ0|FTSA_STAAR       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|Q6GA27|FTSA_STAAS       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|Q8NX33|FTSA_STAAW       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGL-TKVNGGFIVT
sw|Q5HGP6|FTSA_STAAC       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|P63764|FTSA_STAAM       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|P63765|FTSA_STAAN       SDETV---QYTQKDLSDFIEARVEEIFFEVFDVLQ----------DLGLT-KVNGGFIVT
sw|Q44774|FTSA_BORBU       TRPPQ---EKSRKELSVIINSRLREIFEMMKAEIL----------KRGLYNKINGGIVLT
sw|P47203|FTSA_PSEAE       DRPPR---ELSRQALAEVVEPRYDELFTLVQAELR----------RSGYEDLIPAGIVLT
sw|P45068|FTSA_HAEIN       GRAPR---SLTKSDLSLITSARYTELLGVVKDELDK---LKAELEAKHIKFELIAGVVIT
sw|P0ABH2|FTSA_ECO57       GRPPR---SLQRQTLAEVIEPRYTELLNLVNEEILQ---LQEKLRQQGVKHHLAAGIVLT
sw|P0ABH1|FTSA_ECOL6       GRPPR---SLQRQTLAEVIEPRYTELLNLVNEEILQ---LQEKLRQQGVKHHLAAGIVLT
sw|P0ABH0|FTSA_ECOLI       GRPPR---SLQRQTLAEVIEPRYTELLNLVNEEILQ---LQEKLRQQGVKHHLAAGIVLT
sw|P0ABH3|FTSA_SHIFL       GRPPR---SLQRQTLAEVIEPRYTELLNLVNEEILQ---LQEKLRQQGVKHHLAAGIVLT
sw|Q89AQ4|FTSA_BUCBP       TIIQT----FHKDKLTEVIESRYIELLTLINEEIKN---TQKKLKKSGRIHKLGAGIVLT
sw|P57309|FTSA_BUCAI       CNFQQ---NLQQDALIDVIESRYVELLSLVQDQIVH---LQKKLHKKGEKYELLSGIVLT
sw|O51928|FTSA_BUCAP       GNFQK---NLQQDTVIEVIESRYNELLHLINNRILY---VQKKLYKEGRKYQLTGGIVLT
sw|P28264|FTSA_BACSU       TNQKQ---TFTQQEAANIIEARVEEILEIVSEELR----------SMGITDLPG-GFVLT
sw|O07111|FTSA_ENTFA       KSEPV---RVDERYLSEIIEARVEQILRKSKEVLD----------EIDAFELPG-GVVLT
sw|O07672|FTSA_ENTHR       QSEPV---KVDERYLSEVISARMEQIFNKAKEALD----------QIEALELPG-GIVLT
                                                                                     : 

sw|P49298|CISY_CITMA       GFGHGVLRK---------------------------TDPRY-TCQREFALK-------HL
sw|P32444|MBL_BACC1        G-GGALLHG---------------------------IDMLL---AEELKVP---------
sw|P39751|MBL_BACSU        G-GGALLNG---------------------------LDQLL---AEELKVP---------
sw|P39763|MREBH_BACSU      G-GGALLNG---------------------------IKEWL---TEEIVVP---------
sw|Q01465|MREB_BACSU       G-GGALLRN---------------------------LDKVI---SEETKMP---------
sw|P0A9X5|MREB_ECOL6       G-GGALLRN---------------------------LDRLL---MEETGIP---------
sw|P0A9X4|MREB_ECOLI       G-GGALLRN---------------------------LDRLL---MEETGIP---------
sw|P0A9X7|MREB_SALTI       G-GGALLRN---------------------------LDRLL---MEETGIP---------
sw|P0A9X6|MREB_SALTY       G-GGALLRN---------------------------LDRLL---MEETGIP---------
sw|P0A9X8|MREB_SHIFL       G-GGALLRN---------------------------LDRLL---MEETGIP---------
sw|P44474|MREB_HAEIN       G-GGALLRN---------------------------IDILL---SKESGVP---------
sw|Q9L6A3|MREB_PASMU       G-GGALIRN---------------------------IDVLL---SKETGVP---------
sw|Q8Y0L9|HSCA_RALSO       A-S--LLAGNRA-AGDDWLLLDVIPLSLGVETMGGLVEKII---PRNSTIPVARAQEFTT
sw|Q51382|HSCA_PSEAE       A-D--ALAGNKR--GEELLLLDVIPLSLGLETMGGLMEKVI---PRNTTIPVARAQEFTT
sw|Q886Z7|HSCA_PSESM       A-D--TLAGNKR-DGGELLLLDVIPLSLGLETMGGLMEKVI---PRNTTIPVARGQEFTT
sw|Q7NAU6|DNAK_MYCGA       G-G--VLRG----DVKDILLLDVTPLTLAIETLGGVATPII---KRNTTIPVSKSQIFST
sw|P75344|DNAK_MYCPN       G-G--VLRG----DVKDVLLLDVTPLTLSIETLGGVATPLI---KRNTTIPVSKSQIFST
sw|Q9HHB9|DNAK_HALME       G-G--VLGG----EVDDIVLLDVTPLSLGIEVKGGLFERLI---EKNTTIPTEESKIFTT
sw|Q8EPW4|DNAK_OCEIH       G-G--VLQG----DVKDVLLLDVTPLSLGIETMGAVTTKLI---ERNTTIPTSASQTFST
sw|Q9WYK6|DNAK_THEMA       A-A--ILAGTEGAKGRDIVLVDVTPLTLGIEVKGGLFEPII---PRNTKIPVRKSKIFTT
sw|Q9ZAD3|DNAK_PORGI       G-G--VLTG----EVKDVLLLDVTPLSLGIETMGGVMTRLI---DANTTIPTKKSEIFTT
sw|Q9XCB1|DNAK_RHOMR       A-G--VLSG----EVQDVLLLDVTPLNLGIETLGGVMTVLI---PANTTIPTRKSEIFTT
sw|O07827|FTSA_PORGI       G-GGTKINN-------------------YMAAMKKILGEVT---PAKIRMDRIDTDNAIS
sw|P0A331|FTSA_AGRT5       G-GASQLTG-----------------------LPETARRIL-ARNVRIGRP---------
sw|P0A332|FTSA_AGRTU       G-GASQLTG-----------------------LPETARRIL-ARNVRIGRP---------
sw|O30994|FTSA_RHIME       G-GASQLTG-----------------------LPEAARRIL-ARNVRIGRP---------
sw|Q9ZKM3|FTSA_HELPJ       G-GMALMKG-----------------------IKELARTHFTNYPVRLATPVEK------
sw|O25629|FTSA_HELPY       G-GMALMKG-----------------------IKELARTHFTNYPVRLAAPVEK------
sw|Q5HQ07|FTSA_STAEQ       G-GSANLLG-----------------------VKELLQDMV-SEKVRIHTP---------
sw|Q8CPK5|FTSA_STAES       G-GSANLLG-----------------------VKELLQDMV-SEKVRIHTP---------
sw|O07325|FTSA_STAAU       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|Q6GHQ0|FTSA_STAAR       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|Q6GA27|FTSA_STAAS       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|Q8NX33|FTSA_STAAW       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|Q5HGP6|FTSA_STAAC       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|P63764|FTSA_STAAM       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|P63765|FTSA_STAAN       G-GSANLLG-----------------------VKELLSDMV-SEKVRIHTP---------
sw|Q44774|FTSA_BORBU       G-GGALFPG-----------------------ISNLIEEVF-NYPARIGLP---------
sw|P47203|FTSA_PSEAE       G-GTSKMEG-----------------------AVELAEEIF-HMPVRLGVP---------
sw|P45068|FTSA_HAEIN       G-GGAQIED-----------------------LKECASNVF-HCQVRIASP---------
sw|P0ABH2|FTSA_ECO57       G-GAAQIEG-----------------------LAACAQRVF-HTQVRIGAP---------
sw|P0ABH1|FTSA_ECOL6       G-GAAQIEG-----------------------LAACAQRVF-HTQVRIGAP---------
sw|P0ABH0|FTSA_ECOLI       G-GAAQIEG-----------------------LAACAQRVF-HTQVRIGAP---------
sw|P0ABH3|FTSA_SHIFL       G-GAAQIEG-----------------------LAACAQRVF-HTQVRIGAP---------
sw|Q89AQ4|FTSA_BUCBP       G-GASNIKL-----------------------FKNCAEKVF-NIPVRIGCP---------
sw|P57309|FTSA_BUCAI       G-GGSNISC-----------------------LTDCAEKVF-QKKVRVAKP---------
sw|O51928|FTSA_BUCAP       G-GASTISF-----------------------LTECAEKIF-QKKIRIAKP---------
sw|P28264|FTSA_BACSU       G-GQAAMPG-----------------------VMSLAQDVL-QNNVRVQGP---------
sw|O07111|FTSA_ENTFA       G-GAASMPG-----------------------IVDLAQEIF-EANVKLYVP---------
sw|O07672|FTSA_ENTHR       G-GAASLPG-----------------------VVDLAQEIF-GVNVKLYVP---------
                           .     :                                                     

sw|P49298|CISY_CITMA       PDDPLFQLVSKLYEVVPPILTK-------------LGKV---------------------
sw|P32444|MBL_BACC1        -----------VLIAENPMHCVAVG-----------------------------------
sw|P39751|MBL_BACSU        -----------VLVAENPMDCVAIG-----------------------------------
sw|P39763|MREBH_BACSU      -----------VHVAQNPLESVAIG-----------------------------------
sw|Q01465|MREB_BACSU       -----------VLIAEDPLDCVAIG-----------------------------------
sw|P0A9X5|MREB_ECOL6       -----------VVVAEDPLTCVARG-----------------------------------
sw|P0A9X4|MREB_ECOLI       -----------VVVAEDPLTCVARG-----------------------------------
sw|P0A9X7|MREB_SALTI       -----------VVVAEDPLTCVARG-----------------------------------
sw|P0A9X6|MREB_SALTY       -----------VVVAEDPLTCVARG-----------------------------------
sw|P0A9X8|MREB_SHIFL       -----------VVVAEDPLTCVARG-----------------------------------
sw|P44474|MREB_HAEIN       -----------VIIAEDPLTCVARG-----------------------------------
sw|Q9L6A3|MREB_PASMU       -----------VIIADDPLTCVARG-----------------------------------
sw|Q8Y0L9|HSCA_RALSO       FKDGQTAMAIHVLQGERELAGDCRS----------LARFELRGIPPMVAGAARIRVTYQV
sw|Q51382|HSCA_PSEAE       YKDGQTAMMIHVLQGERELVKDCRS----------LARFELRGIPPMVAGAAKIRVTFQV
sw|Q886Z7|HSCA_PSESM       YKDGQTAMKIHVLQGERELVSDCRS----------LARFELRGIPPMVAGAAKIRVTFQV
sw|Q7NAU6|DNAK_MYCGA       AQDNQESVDVSIYQGERPMARENKS----------LGTFSLGGIQPAPKGKPQIEITFNI
sw|P75344|DNAK_MYCPN       AQDNQESVDVVVCQGERPMARDNKS----------LGRFNLGGIQPAPKGKPQIEITFSL
sw|Q9HHB9|DNAK_HALME       AADNQTTVQVRVFQGEREMAEDNEL----------LGEFTLSGIPPAPAGTPQIEVGFNI
sw|Q8EPW4|DNAK_OCEIH       AADNQTAVDIHVLQGEREMASDNKT----------LGRFQLTDIPPAPRGMPQIEVSFDI
sw|Q9WYK6|DNAK_THEMA       VEDGQTEVEIRVYQGERPIARENIF----------LGSFKLVGIPPAPRGVPQIEVTFDI
sw|Q9ZAD3|DNAK_PORGI       AVDNQPSVEIHVLQGERSLAKDNKS----------IGRFNLDGIAPAPRQTPQIEVTFDI
sw|Q9XCB1|DNAK_RHOMR       ASDNQTSVEIHVLQGNREMAADNRS----------LGRFILDGIPPAPRGVPQIEVTFDI
sw|O07827|FTSA_PORGI       FIEEHISTIGLAYKATQPCTDYITT-----------------------------------
sw|P0A331|FTSA_AGRT5       -----MGVAGLPVAAKGPAFSTACG----------LMIY---------------------
sw|P0A332|FTSA_AGRTU       -----MGVAGLPVAAKGPAFSTACG----------LMIY---------------------
sw|O30994|FTSA_RHIME       -----LGVSGLPAAAKGPAFSTAVG----------LMIY---------------------
sw|Q9ZKM3|FTSA_HELPJ       -----YNIMGMFEDLKDPRFSVVVG----------LILYKAGG-----------HTNYER
sw|O25629|FTSA_HELPY       -----YNIMGMFEDLKDPRFSVVVG----------LILYKAGG-----------HTNYER
sw|Q5HQ07|FTSA_STAEQ       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTISY
sw|Q8CPK5|FTSA_STAES       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTISY
sw|O07325|FTSA_STAAU       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|Q6GHQ0|FTSA_STAAR       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|Q6GA27|FTSA_STAAS       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|Q8NX33|FTSA_STAAW       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|Q5HGP6|FTSA_STAAC       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|P63764|FTSA_STAAM       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|P63765|FTSA_STAAN       ----------SQMGIRKPEFSSAISTISSSIAFDELLDY----------------VTINY
sw|Q44774|FTSA_BORBU       -----MSINGIGEEHIDPKFSSALG----------LVLY---------------------
sw|P47203|FTSA_PSEAE       -----YSVKGLTDVVRNPIYSTGVG----------LLMYGL-------------------
sw|P45068|FTSA_HAEIN       -----LNITGLTDYVNRPQYSTVVG----------LLQYNY-------------------
sw|P0ABH2|FTSA_ECO57       -----LNITGLTDYAQEPYYSTAVG----------LLHY---------------------
sw|P0ABH1|FTSA_ECOL6       -----LNITGLTDYAQEPYYSTAVG----------LLHY---------------------
sw|P0ABH0|FTSA_ECOLI       -----LNITGLTDYAQEPYYSTAVG----------LLHY---------------------
sw|P0ABH3|FTSA_SHIFL       -----LNITGLTDYAQEPYYSTAVG----------LLHY---------------------
sw|Q89AQ4|FTSA_BUCBP       -KKNNINTAKLTNNTQTGSLSTVIG----------LLYF---------------------
sw|P57309|FTSA_BUCAI       -----FNISGLIEKITEPCYSTVIG----------LLHY---------------------
sw|O51928|FTSA_BUCAP       -----LNISGLTDNVTEPHYSTVVG----------LLHY---------------------
sw|P28264|FTSA_BACSU       ----------NYIGVRDPQYMTGVG----------LIQF---------------------
sw|O07111|FTSA_ENTFA       ----------NHMGLRNPVFANVIS----------IVEY---------------------
sw|O07672|FTSA_ENTHR       ----------NQMGLRNPVFTNVIS----------IVDYS--------------------
                                                                                       

sw|P49298|CISY_CITMA       ---------------------------KNPWPNVDAHSGVLLNHFG--LAEARYYTVLFG
sw|P32444|MBL_BACC1        --------------------------TGIMLENIDRLPKRALR-----------------
sw|P39751|MBL_BACSU        --------------------------TGVMLDNMDKLPKRKLS-----------------
sw|P39763|MREBH_BACSU      --------------------------TGRSLEVIDKLQKAIK------------------
sw|Q01465|MREB_BACSU       --------------------------TGKALEHIHLFKGKTR------------------
sw|P0A9X5|MREB_ECOL6       --------------------------GGKALEMIDMHGGDLFSEE---------------
sw|P0A9X4|MREB_ECOLI       --------------------------GGKALEMIDMHGGDLFSEE---------------
sw|P0A9X7|MREB_SALTI       --------------------------GGKALEMIDMHGGDLFSEE---------------
sw|P0A9X6|MREB_SALTY       --------------------------GGKALEMIDMHGGDLFSEE---------------
sw|P0A9X8|MREB_SHIFL       --------------------------GGKALEMIDMHGGDLFSEE---------------
sw|P44474|MREB_HAEIN       --------------------------GGEALEMIDMHGGDIFSDEI--------------
sw|Q9L6A3|MREB_PASMU       --------------------------GGEALEMIDMHGGDIFSDDI--------------
sw|Q8Y0L9|HSCA_RALSO       DADGLLSVSARETVSGVEASIAVKPSYGLGDDDIARMLQEGFQSAEEDMRRRALAEERVE
sw|Q51382|HSCA_PSEAE       DADGLLGVSARELSSGVEASIQVKPSYGLTDGEIARMLKDSFDYAGDDKAARALREQQVE
sw|Q886Z7|HSCA_PSESM       DADGLLSVSAREMGSGIESSIQVKPSYGLTDDEVTRMLKDSFEYAGDDKVARVLREHQVD
sw|Q7NAU6|DNAK_MYCGA       DANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAIVKQRIEMRYE
sw|P75344|DNAK_MYCPN       DANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNE
sw|Q9HHB9|DNAK_HALME       DENGIVNVSAEDKGSGNAESITIEGGAGLSDDEIDRMQREAEQHAEEDKERRRAVEARNE
sw|Q8EPW4|DNAK_OCEIH       DANGIVNVRAKDLGTNKEQSITIKSSSGLSDDEVDRMVKEAEENADADKQRREEVDLRNE
sw|Q9WYK6|DNAK_THEMA       DSDGIVHVSAKDLGSGKEQSMVVTGRHKLSEDEIKRMIEDAKRYEEQDKRLKEEIELKNR
sw|Q9ZAD3|DNAK_PORGI       DANGILNVTAHDKATGKKQNIRIEASSGLSDDEIKRMKEEAQANAEADKKEKERIDKINQ
sw|Q9XCB1|DNAK_RHOMR       DANGILHVSARDKATGKEQSIRIEASSGLTPEEIERMREEARRHAAEDRKRREQIEKLNQ
sw|O07827|FTSA_PORGI       --------NLGELVSQIETKEEIPANDTVQDLFAQGRQTERKENEQRDNTDRQREDTPKQ
sw|P0A331|FTSA_AGRT5       --------------------------PQVADIEIHAAQGGMFSPFGNGS-----------
sw|P0A332|FTSA_AGRTU       --------------------------PQVADIEIHAAQGGMFSPFGNGS-----------
sw|O30994|FTSA_RHIME       --------------------------PQVADLETHAAGSGMFSTLGGNSR----------
sw|Q9ZKM3|FTSA_HELPJ       DSKGIIR-------------------YHESDDYIRKAHQSNPTPHIHSSPTERNLSDLKT
sw|O25629|FTSA_HELPY       DSKGVIR-------------------YHESDDYTRTAHQSSPTPHIHSSPTERNLSDLKA
sw|Q5HQ07|FTSA_STAEQ       QDNEEFEEEVIESDKDSETKS-----SGFDWFKRKSNKKENDEVAPEAPREESYEDRENH
sw|Q8CPK5|FTSA_STAES       QDNEEFEEEVIETDKDTETKS-----SGFDWFKRKSNKKENDEVAPEAPREESYEDRENH
sw|O07325|FTSA_STAAU       HDNEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|Q6GHQ0|FTSA_STAAR       HDNEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESSDEEIYQSEDNH
sw|Q6GA27|FTSA_STAAS       HDSEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|Q8NX33|FTSA_STAAW       HDSEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|Q5HGP6|FTSA_STAAC       HDNEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|P63764|FTSA_STAAM       HDNEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|P63765|FTSA_STAAN       HDNEETEEDVIDVKDKDNESKL----GGFDWFKRKTNKKDTHENEVESTDEEIYQSEDNH
sw|Q44774|FTSA_BORBU       ---------------------------KHEQQKFNKLKKVSSKVKRKNK-----------
sw|P47203|FTSA_PSEAE       --------------------------QKQSDGMSMSVSGSSYSSDEPKA-----------
sw|P45068|FTSA_HAEIN       --------------------------SNSDDDLISGSDDSEGTFFESIW-----------
sw|P0ABH2|FTSA_ECO57       --------------------------GKESHLNGEAEVEKRVTASVGSW-----------
sw|P0ABH1|FTSA_ECOL6       --------------------------GKESHLNGEAEVEKRVTASVGSW-----------
sw|P0ABH0|FTSA_ECOLI       --------------------------GKESHLNGEAEVEKRVTASVGSW-----------
sw|P0ABH3|FTSA_SHIFL       --------------------------GKESHLNGEAEVEKRVTASVGSW-----------
sw|Q89AQ4|FTSA_BUCBP       ---------------------------GKKYFYSHRNKNSYNFFK---------------
sw|P57309|FTSA_BUCAI       --------------------------GKESYINIDKKKKEHSFFEI--------------
sw|O51928|FTSA_BUCAP       ---------------------------GKEFYFDDTNQKREISFIE--------------
sw|P28264|FTSA_BACSU       ---------------------------ACRNARIQGRKIGFKMPEEAIQEIAVSSSEEQE
sw|O07111|FTSA_ENTFA       ---------------------------SAQLNDIYHIAKYAIPGEKSKPAQSVAVQQEVR
sw|O07672|FTSA_ENTHR       --------------------------ANLSEVYQLAKIAVTGETVVAHHTTVEQEVTSYD
                                                                                       

sw|P49298|CISY_CITMA       VSRSLGICSQLIWDRALGLPLERPKSVTLDWIEKNCKKAA--------------------
sw|P32444|MBL_BACC1        ------------------------------------------------------------
sw|P39751|MBL_BACSU        ------------------------------------------------------------
sw|P39763|MREBH_BACSU      ------------------------------------------------------------
sw|Q01465|MREB_BACSU       ------------------------------------------------------------
sw|P0A9X5|MREB_ECOL6       ------------------------------------------------------------
sw|P0A9X4|MREB_ECOLI       ------------------------------------------------------------
sw|P0A9X7|MREB_SALTI       ------------------------------------------------------------
sw|P0A9X6|MREB_SALTY       ------------------------------------------------------------
sw|P0A9X8|MREB_SHIFL       ------------------------------------------------------------
sw|P44474|MREB_HAEIN       ------------------------------------------------------------
sw|Q9L6A3|MREB_PASMU       ------------------------------------------------------------
sw|Q8Y0L9|HSCA_RALSO       GERLLEALSHALDADGD-LLSADERAAVDAQVAALRVTLQGED--HRAIKDAVDALSHGT
sw|Q51382|HSCA_PSEAE       AQRLLEAVQSALDVDGERLLDEEERLAIAAQMDTLRELAGGSD--TAAIENQIKRLSQVT
sw|Q886Z7|HSCA_PSESM       AERLLEAVQGALDADGERLLDEEERLVINLQMDELRELMQGTD--GYAIEQQTKRLSQVT
sw|Q7NAU6|DNAK_MYCGA       GEGIVNTINEILGSKEAEALPAQEKASLTKIVDGINGALKAEK--WDELKEQIDGFKK-W
sw|P75344|DNAK_MYCPN       GESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKAND--YTKLKAEIENFKK-W
sw|Q9HHB9|DNAK_HALME       AEGAVQRAETLLEENE-ENVDDELRADIEAAIEDVEAVLEDDDASTDELEDVTEDLSKEL
sw|Q8EPW4|DNAK_OCEIH       ADQLIFTTDKTIKDLD-DKVSEEDKQKAESAKDELKQALESGD--MEQVKAKKDALEEHV
sw|Q9WYK6|DNAK_THEMA       ADDLAYSVEKTLKEHG-DKIPADLKSRLEDMIRELRDAINRND--IPKVKMLFDDLQKES
sw|Q9ZAD3|DNAK_PORGI       ADSMIFQTEKQLKELG-DKFPADKKAPIDTALDKLKEAHKAQD--VAAIDTAMAELQTAL
sw|Q9XCB1|DNAK_RHOMR       ADSLIYMTEKNLREYG-DKLPADKRAKIESALERLKEVHKARN--FDELDSAIAQLNQAW
sw|O07827|FTSA_PORGI       TVKKKEKTGPSFGDKL-----KGAFIKFGSLFDEDTNQDNNR------------------
sw|P0A331|FTSA_AGRT5       ----------------------GRIARVGQWLKESF------------------------
sw|P0A332|FTSA_AGRTU       ----------------------GRIARVGQWLKESF------------------------
sw|O30994|FTSA_RHIME       ------------------------FARMGQWLKESF------------------------
sw|Q9ZKM3|FTSA_HELPJ       PSAPLNTAKNDDFLPIKPTEQKGFFQNLLDKISKIF------------------------
sw|O25629|FTSA_HELPY       PSAPLNTAKNDDFLPIKPTEQKGFFKSFLDKISKFF------------------------
sw|Q5HQ07|FTSA_STAEQ       LEDEQQTEGKA-----------KEESKFKKLMKSLFE-----------------------
sw|Q8CPK5|FTSA_STAES       LEDEQQTEGKA-----------KEESKFKKLMKSLFE-----------------------
sw|O07325|FTSA_STAAU       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|Q6GHQ0|FTSA_STAAR       QEHKQNHEHVQDKDKE--------ESKFKKLMKSLFE-----------------------
sw|Q6GA27|FTSA_STAAS       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|Q8NX33|FTSA_STAAW       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|Q5HGP6|FTSA_STAAC       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|P63764|FTSA_STAAM       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|P63765|FTSA_STAAN       QEHKQNHEHVQDKDKD------KEESKFKKLMKSLFE-----------------------
sw|Q44774|FTSA_BORBU       -----------------------ISSKLKGWFLKEWF-----------------------
sw|P47203|FTSA_PSEAE       ----------------------PVLERLKRWVQGNF------------------------
sw|P45068|FTSA_HAEIN       ----------------------QGVKKIVNKVRSEF------------------------
sw|P0ABH2|FTSA_ECO57       ------------------------IKRLNSWLRKEF------------------------
sw|P0ABH1|FTSA_ECOL6       ------------------------IKRLNSWLRKEF------------------------
sw|P0ABH0|FTSA_ECOLI       ------------------------IKRLNSWLRKEF------------------------
sw|P0ABH3|FTSA_SHIFL       ------------------------IKRLNSWLRKEFDANGLINGDRPIRBCEECA-----
sw|Q89AQ4|FTSA_BUCBP       ----------------------KWLQYINNWIKKEF------------------------
sw|P57309|FTSA_BUCAI       -----------------------IFKRINNWFKKEF------------------------
sw|O51928|FTSA_BUCAP       ----------------------KWFQKISNWFKKEF------------------------
sw|P28264|FTSA_BACSU       QHHHQNEVQQRPKGKQKTQAEHNKQSKMKKLLSMFWE-----------------------
sw|O07111|FTSA_ENTFA       YDTYAEQPQEEYEEFNERESGEKVTGKIKDFFSNIFD-----------------------
sw|O07672|FTSA_ENTHR       NDSYDAPEETVYDEPEQKKSDEDVTTKIKGFFSKIFD-----------------------
                                                                                       

sw|P49298|CISY_CITMA       --------------------------------------------------------
sw|P32444|MBL_BACC1        --------------------------------------------------------
sw|P39751|MBL_BACSU        --------------------------------------------------------
sw|P39763|MREBH_BACSU      --------------------------------------------------------
sw|Q01465|MREB_BACSU       --------------------------------------------------------
sw|P0A9X5|MREB_ECOL6       --------------------------------------------------------
sw|P0A9X4|MREB_ECOLI       --------------------------------------------------------
sw|P0A9X7|MREB_SALTI       --------------------------------------------------------
sw|P0A9X6|MREB_SALTY       --------------------------------------------------------
sw|P0A9X8|MREB_SHIFL       --------------------------------------------------------
sw|P44474|MREB_HAEIN       --------------------------------------------------------
sw|Q9L6A3|MREB_PASMU       --------------------------------------------------------
sw|Q8Y0L9|HSCA_RALSO       DEFAARRMDRGIRAALAGK-----RIEELG--------------------------
sw|Q51382|HSCA_PSEAE       DAFAARRMDATVKAALSGR-----RLNEIEE-------------------------
sw|Q886Z7|HSCA_PSESM       DAFAARRLDSTVKAALAGR-----NLNEIEE-------------------------
sw|Q7NAU6|DNAK_MYCGA       RDDMSKKYG---------------GGEAPAEPK-----------------------
sw|P75344|DNAK_MYCPN       REEMAKKYN---------------PNGDQGQPAQ----------------------
sw|Q9HHB9|DNAK_HALME       QEIGKRMYQQQAQAQAGGPGGAGGPGGADGPGADADPEDFVDADADFDDEDDDE--
sw|Q8EPW4|DNAK_OCEIH       QQLSAKLYEQVQQE--AQQ-----ASGEQGEESGNQDDDVVDADYSEVDDDDKK--
sw|Q9WYK6|DNAK_THEMA       MKIGEYLYKSAT----GGE-----TSN----------------------------Q
sw|Q9ZAD3|DNAK_PORGI       SAAGEELYKNAGAAQGGAQ-----PGPDFGGAQGPSAGDQPSDDKNVTDVDFEEVK
sw|Q9XCB1|DNAK_RHOMR       NEASQDLYRAQQAA--GAQ-----TSD--GASAQADSGGVREADYEVIDEDDKDKQ
sw|O07827|FTSA_PORGI       --------------------------------------------------------
sw|P0A331|FTSA_AGRT5       --------------------------------------------------------
sw|P0A332|FTSA_AGRTU       --------------------------------------------------------
sw|O30994|FTSA_RHIME       --------------------------------------------------------
sw|Q9ZKM3|FTSA_HELPJ       --------------------------------------------------------
sw|O25629|FTSA_HELPY       --------------------------------------------------------
sw|Q5HQ07|FTSA_STAEQ       --------------------------------------------------------
sw|Q8CPK5|FTSA_STAES       --------------------------------------------------------
sw|O07325|FTSA_STAAU       --------------------------------------------------------
sw|Q6GHQ0|FTSA_STAAR       --------------------------------------------------------
sw|Q6GA27|FTSA_STAAS       --------------------------------------------------------
sw|Q8NX33|FTSA_STAAW       --------------------------------------------------------
sw|Q5HGP6|FTSA_STAAC       --------------------------------------------------------
sw|P63764|FTSA_STAAM       --------------------------------------------------------
sw|P63765|FTSA_STAAN       --------------------------------------------------------
sw|Q44774|FTSA_BORBU       --------------------------------------------------------
sw|P47203|FTSA_PSEAE       --------------------------------------------------------
sw|P45068|FTSA_HAEIN       --------------------------------------------------------
sw|P0ABH2|FTSA_ECO57       --------------------------------------------------------
sw|P0ABH1|FTSA_ECOL6       --------------------------------------------------------
sw|P0ABH0|FTSA_ECOLI       --------------------------------------------------------
sw|P0ABH3|FTSA_SHIFL       --------------------------------------------------------
sw|Q89AQ4|FTSA_BUCBP       --------------------------------------------------------
sw|P57309|FTSA_BUCAI       --------------------------------------------------------
sw|O51928|FTSA_BUCAP       --------------------------------------------------------
sw|P28264|FTSA_BACSU       --------------------------------------------------------
sw|O07111|FTSA_ENTFA       --------------------------------------------------------
sw|O07672|FTSA_ENTHR       --------------------------------------------------------
                                                                                   
PLEASE NOTE: Showing colors on large alignments is slow.

spacer
spacer