Header of the page

BLASTP 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1141995476-13779-73601527262.BLASTQ1


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           3,423,372 sequences; 1,168,150,132 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs


Results of PSI-Blast iteration 1
Taxonomy reports
Query= FTSA_ECOLI Length=420

Distribution of 500 Blast Hits on the Query Sequence




Legend:

New sequence mark - means that the alignment score was below the threshold on the previous iteration

Checked mark - means that the alignment was checked on the previous iteration


Hit list size
Sequences with E-value BETTER than threshold
Related Structures     Score E Sequences producing significant alignments:    (Bits) Value New sequence mark gi|78100129|sp|P0ABH3|FTSA_SHIFL Cell division protein ftsA 823 0.0 New sequence mark gi|24050298|gb|AAN41756.1| ATP-binding cell division protein ... 818 0.0 Gene info New sequence mark gi|146032|gb|AAA23817.1| FtsA [Escherichia coli] >gi|146025|g... 816 0.0 New sequence mark gi|16418632|gb|AAL19096.1| ATP-binding cell division protein ... 795 0.0 Gene info New sequence mark gi|85058430|ref|YP_454132.1| cell division protein FtsA [Soda... 776 0.0 Gene info New sequence mark gi|75175651|ref|ZP_00695859.1| COG0849: Actin-like ATPase inv... 770 0.0 New sequence mark gi|45438226|gb|AAS63773.1| cell division protein FtsA [Yersin... 767 0.0 Gene info New sequence mark gi|36786949|emb|CAE16023.1| cell division protein [Photorhabd... 767 0.0 Gene info New sequence mark gi|49613259|emb|CAG76710.1| cell division protein [Erwinia ca... 763 0.0 Gene info New sequence mark gi|71796038|gb|AAZ40789.1| cell division protein [Candidatus ... 666 0.0 Gene info New sequence mark gi|46914741|emb|CAG21518.1| putative cell division protein Ft... 641 0.0 Gene info New sequence mark gi|25166158|dbj|BAC24349.1| ftsA [Wigglesworthia glossinidia ... 641 0.0 Gene info New sequence mark gi|89074167|ref|ZP_01160666.1| cell division protein [Photoba... 639 0.0 New sequence mark gi|75234331|ref|ZP_00718709.1| COG0849: Actin-like ATPase inv... 624 2e-177 New sequence mark gi|33517282|emb|CAD83666.1| cell division protein FtsA [Candi... 621 1e-176 Gene info New sequence mark gi|9656971|gb|AAF95541.1| cell division protein FtsA [Vibrio ... 604 2e-171 Gene info New sequence mark gi|28805446|dbj|BAC58726.1| cell division protein FtsA [Vibri... 597 3e-169 Gene info New sequence mark gi|75853564|ref|ZP_00761381.1| COG0849: Actin-like ATPase inv... 596 6e-169 New sequence mark gi|37197542|dbj|BAC93381.1| cell division protein FtsA [Vibri... 593 6e-168 Gene info New sequence mark gi|59712804|ref|YP_205580.1| cell division protein [Vibrio fi... 590 3e-167 Gene info New sequence mark gi|86148543|ref|ZP_01066830.1| cell division protein [Vibrio ... 589 6e-167 New sequence mark gi|27360153|gb|AAO09091.1| Cell division protein FtsA [Vibrio... 577 3e-163 Gene info New sequence mark gi|71145113|gb|AAZ25586.1| cell division protein FtsA [Colwel... 516 9e-145 Gene info New sequence mark gi|82742141|ref|ZP_00904843.1| Cell division protein FtsA [Sh... 512 1e-143 New sequence mark gi|24375701|ref|NP_719744.1| cell division protein FtsA [Shew... 511 2e-143 Gene info New sequence mark gi|68547969|ref|ZP_00587491.1| Cell division protein FtsA [Sh... 507 3e-142 New sequence mark gi|69951271|ref|ZP_00639012.1| Cell division protein FtsA [Sh... 506 8e-142 New sequence mark gi|78368229|ref|ZP_00838470.1| Cell division protein FtsA [Sh... 504 2e-141 New sequence mark gi|21623112|gb|AAM67771.1| cell division protein FtsA [Buchne... 501 2e-140 Gene info New sequence mark gi|82495625|ref|ZP_00881199.1| Cell division protein FtsA [Sh... 500 4e-140 New sequence mark gi|85712529|ref|ZP_01043577.1| Cell division ATPase, FtsA [Id... 500 4e-140 New sequence mark gi|68543485|ref|ZP_00583188.1| Cell division protein FtsA [Sh... 500 4e-140 New sequence mark gi|2738588|gb|AAC46068.1| cell division protein [Buchnera aphidi 499 6e-140 New sequence mark gi|11761338|dbj|BAB19205.1| FtsA [Shewanella violacea] 499 1e-139 New sequence mark gi|10038895|dbj|BAB12930.1| cell division protein ftsA [Buchn... 497 4e-139 Gene info New sequence mark gi|76794187|ref|ZP_00776661.1| Cell division protein FtsA [Ps... 494 4e-138 New sequence mark gi|56178561|gb|AAV81283.1| Cell division ATPase, FtsA [Idioma... 491 3e-137 Gene info New sequence mark gi|27904093|gb|AAO26927.1| cell division protein FtsA [Buchne... 470 5e-131 Gene info New sequence mark gi|76876326|emb|CAI87548.1| Cell division protein [Pseudoalte... 468 1e-130 Gene info New sequence mark gi|88858806|ref|ZP_01133447.1| Cell division protein [Pseudoa... 466 1e-129 New sequence mark gi|88794391|ref|ZP_01110099.1| cell division protein FtsA [Al... 465 1e-129 New sequence mark gi|68057890|gb|AAX88143.1| cell division protein FtsA [Haemop... 455 2e-126 Gene info New sequence mark gi|1169751|sp|P45068|FTSA_HAEIN Cell division protein ftsA >g... 449 7e-125 New sequence mark gi|88704104|ref|ZP_01101819.1| Cell division protein FtsA [ga... 433 7e-120 New sequence mark gi|53729115|ref|ZP_00134079.2| COG0849: Actin-like ATPase inv... 431 3e-119 New sequence mark gi|46156643|ref|ZP_00132283.2| COG0849: Actin-like ATPase inv... 422 2e-116 New sequence mark gi|33148197|gb|AAP95717.1| cell division protein FtsA [Haemop... 418 2e-115 Gene info New sequence mark gi|52307769|gb|AAU38269.1| FtsA protein [Mannheimia succinici... 418 2e-115 Gene info New sequence mark gi|75429980|ref|ZP_00732550.1| ATPases of the HSP70 class inv... 417 6e-115 New sequence mark gi|88811833|ref|ZP_01127086.1| Cell division protein FtsA [Ni... 412 1e-113 New sequence mark gi|78701777|ref|ZP_00866224.1| Cell division protein FtsA [Al... 410 7e-113 New sequence mark gi|88949782|ref|ZP_01152397.1| Cell division protein FtsA [Ha... 408 2e-112 New sequence mark gi|83648518|ref|YP_436953.1| cell division protein FtsA [Hahe... 406 7e-112 Gene info New sequence mark gi|12720363|gb|AAK02230.1| FtsA [Pasteurella multocida subsp.... 405 1e-111 Gene info New sequence mark gi|48861175|ref|ZP_00315079.1| COG0849: Actin-like ATPase inv... 405 1e-111 New sequence mark gi|77384893|gb|ABA76406.1| Cell division protein FtsA [Pseudo... 404 4e-111 Gene info New sequence mark gi|66047325|ref|YP_237166.1| Cell division protein FtsA [Pseu... 403 6e-111 Gene info New sequence mark gi|71557836|gb|AAZ37047.1| cell division protein FtsA [Pseudo... 403 6e-111 Gene info New sequence mark gi|26988075|ref|NP_743500.1| cell division protein FtsA [Pseu... 403 7e-111 Gene info New sequence mark gi|67677010|ref|ZP_00473752.1| Cell division protein FtsA [Ch... 402 9e-111 New sequence mark gi|82738698|ref|ZP_00901525.1| Cell division protein FtsA [Ps... 402 1e-110 New sequence mark gi|28871539|ref|NP_794158.1| cell division protein FtsA [Pseu... 402 1e-110 Gene info New sequence mark gi|68346679|gb|AAY94285.1| cell division protein FtsA [Pseudo... 402 1e-110 Gene info New sequence mark gi|2707899|gb|AAB92376.1| FtsA [Pseudomonas putida] 402 2e-110 New sequence mark gi|77955512|ref|ZP_00819874.1| Cell division protein FtsA [Ma... 402 2e-110 New sequence mark gi|9950640|gb|AAG07796.1| cell division protein FtsA [Pseudom... 401 3e-110 Gene info New sequence mark gi|53757202|gb|AAU91493.1| cell division protein FtsA [Methyl... 400 5e-110 Gene info New sequence mark gi|67156140|ref|ZP_00417766.1| Cell division protein FtsA [Az... 399 1e-109 New sequence mark gi|76884621|gb|ABA59302.1| Cell division protein FtsA [Nitros... 399 1e-109 Gene info New sequence mark gi|89093035|ref|ZP_01165986.1| cell division protein FtsA [Oc... 399 1e-109 New sequence mark gi|88799420|ref|ZP_01114997.1| cell division protein FtsA [Re... 391 2e-107 New sequence mark gi|34499794|ref|NP_904009.1| cell division protein ftsA [Chro... 390 7e-107 Gene info New sequence mark gi|74316142|ref|YP_313882.1| Cell division protein FtsA [Thio... 386 8e-106 Gene info New sequence mark gi|77814543|ref|ZP_00813801.1| Cell division protein FtsA [Sh... 384 4e-105 New sequence mark gi|78363218|gb|ABB41183.1| cell division protein FtsA [Thiomi... 384 6e-105 Gene info New sequence mark gi|29540760|gb|AAO89704.1| cell division protein FtsA [Coxiel... 384 6e-105 Gene info New sequence mark gi|53692772|ref|ZP_00122125.2| COG0849: Actin-like ATPase inv... 380 6e-104 New sequence mark gi|89095255|ref|ZP_01168176.1| Cell division protein FtsA [Oc... 377 7e-103 New sequence mark gi|84369197|dbj|BAE70355.1| cell division protein [Xanthomona... 375 1e-102 Gene info New sequence mark gi|78034820|emb|CAJ22465.1| cell division protein FtsA [Xanth... 375 1e-102 Gene info New sequence mark gi|68214326|ref|ZP_00566150.1| Cell division protein FtsA [Me... 375 2e-102 New sequence mark gi|56312266|emb|CAI06911.1| cell division protein FTSA [Azoar... 372 1e-101 Gene info New sequence mark gi|71550341|ref|ZP_00670466.1| Cell division protein FtsA [Ni... 371 3e-101 New sequence mark gi|28199731|ref|NP_780045.1| cell division protein [Xylella f... 369 2e-100 Gene info New sequence mark gi|71163927|gb|EAO13642.1| Cell division protein FtsA [Xylell... 369 2e-100 New sequence mark gi|87122623|ref|ZP_01078500.1| cell division protein FtsA [Ma... 365 2e-99 New sequence mark gi|9105699|gb|AAF83611.1| cell division protein [Xylella fast... 365 2e-99 Gene info New sequence mark gi|52629927|gb|AAU28668.1| cell division protein FtsA [Legion... 363 6e-99 Gene info New sequence mark gi|53755279|emb|CAH16773.1| ATP-binding cell division protein... 363 6e-99 Gene info New sequence mark gi|71848727|gb|AAZ48223.1| Cell division protein FtsA [Dechlo... 363 6e-99 Gene info New sequence mark gi|82703604|ref|YP_413170.1| cell division protein FtsA [Nitr... 362 2e-98 Gene info New sequence mark gi|52429463|gb|AAU50056.1| cell division protein FtsA [Burkho... 362 2e-98 Gene info New sequence mark gi|30138616|emb|CAD84907.1| Cell division protein FtsA [Nitro... 361 3e-98 Gene info New sequence mark gi|48781047|ref|ZP_00277701.1| COG0849: Actin-like ATPase inv... 360 4e-98 New sequence mark gi|52211045|emb|CAH37033.1| cell division protein FtsA [Burkh... 360 6e-98 Gene info New sequence mark gi|39985101|gb|AAR36456.1| cell division protein FtsA [Geobac... 359 1e-97 Gene info New sequence mark gi|78192892|gb|ABB30659.1| Cell division protein FtsA [Geobac... 359 1e-97 Gene info New sequence mark gi|84360668|ref|ZP_00985364.1| COG0849: Actin-like ATPase inv... 358 2e-97 New sequence mark gi|74020125|ref|ZP_00690731.1| Cell division protein FtsA [Bu... 358 3e-97 New sequence mark gi|77965870|gb|ABB07250.1| Cell division protein FtsA [Burkho... 358 3e-97 Gene info New sequence mark gi|71836424|ref|ZP_00676193.1| Cell division protein FtsA [Pe... 358 3e-97 New sequence mark gi|67548901|ref|ZP_00426780.1| Cell division protein FtsA [Bu... 357 4e-97 New sequence mark gi|68247429|gb|EAN29515.1| Cell division protein FtsA [Magnet... 354 3e-96 New sequence mark gi|33568800|emb|CAE34558.1| cell division protein FtsA [Borde... 353 7e-96 Gene info New sequence mark gi|88937535|ref|ZP_01143097.1| Cell division protein FtsA [Ge... 350 5e-95 New sequence mark gi|17429863|emb|CAD16547.1| PROBABLE CELL DIVISION PROTEIN FT... 347 4e-94 Gene info New sequence mark gi|83748770|ref|ZP_00945785.1| FtsA [Ralstonia solanacearum U... 347 5e-94 New sequence mark gi|72120072|gb|AAZ62335.1| Cell division protein FtsA [Ralsto... 347 6e-94 Gene info New sequence mark gi|68559742|ref|ZP_00599073.1| Cell division protein FtsA [Ra... 346 9e-94 New sequence mark gi|77545874|gb|ABA89436.1| cell division protein FtsA [Peloba... 345 2e-93 Gene info New sequence mark gi|46450324|gb|AAS96972.1| cell division protein FtsA [Desulf... 345 3e-93 Gene info New sequence mark gi|74024661|ref|ZP_00695194.1| Cell division protein FtsA [Rh... 342 2e-92 New sequence mark gi|86160195|ref|YP_466980.1| cell division protein FtsA [Anae... 338 3e-91 Gene info New sequence mark gi|78218498|gb|ABB37847.1| cell division protein FtsA [Desulf... 338 3e-91 Gene info New sequence mark gi|67848311|ref|ZP_00503429.1| Cell division protein FtsA [Po... 337 8e-91 New sequence mark gi|68177554|ref|ZP_00550701.1| Cell division protein FtsA [De... 335 2e-90 New sequence mark gi|84715213|ref|ZP_01022368.1| Cell division protein FtsA [Po... 335 2e-90 New sequence mark gi|47574472|ref|ZP_00244508.1| COG0849: Actin-like ATPase inv... 334 4e-90 New sequence mark gi|71548015|ref|ZP_00668508.1| Cell division protein FtsA [Sy... 331 4e-89 New sequence mark gi|85858530|ref|YP_460732.1| cell division protein [Syntrophu... 325 3e-87 Gene info New sequence mark gi|75821356|ref|ZP_00751283.1| COG0849: Actin-like ATPase inv... 323 7e-87 New sequence mark gi|7380686|emb|CAB85276.1| cell division protein [Neisseria m... 320 9e-86 Gene info New sequence mark gi|7225649|gb|AAF40864.1| cell division protein FtsA [Neisser... 319 2e-85 Gene info New sequence mark gi|59801865|ref|YP_208577.1| FtsA [Neisseria gonorrhoeae FA 1... 316 1e-84 Gene info New sequence mark gi|39576781|emb|CAE80945.1| cell division protein FtsA [Bdell... 300 8e-80 Gene info New sequence mark gi|83572614|gb|ABC19166.1| cell division protein FtsA [Moorel... 300 1e-79 Gene info New sequence mark gi|75822196|ref|ZP_00751871.1| COG0849: Actin-like ATPase inv... 294 4e-78 New sequence mark gi|89210851|ref|ZP_01189235.1| Cell division protein FtsA [Ha... 282 2e-74 New sequence mark gi|50877783|emb|CAG37623.1| probable cell division protein Ft... 278 3e-73 Gene info New sequence mark gi|2688166|gb|AAC66648.1| cell division protein (ftsA) [Borre... 263 1e-68 Gene info New sequence mark gi|83816584|ref|YP_444706.1| cell division protein FtsA [Sali... 262 2e-68 Gene info New sequence mark gi|1200208|emb|CAA78155.1| ftsA [Borrelia burgdorferi] >gi|12... 261 3e-68 New sequence mark gi|24194053|gb|AAN47810.1| Cell division protein ftsA [Leptos... 261 3e-68 Gene info New sequence mark gi|51573132|gb|AAU07157.1| cell division protein [Borrelia ga... 260 6e-68 Gene info New sequence mark gi|45658797|ref|YP_002883.1| FtsA [Leptospira interrogans ser... 260 8e-68 Gene info New sequence mark gi|48854568|ref|ZP_00308730.1| COG0849: Actin-like ATPase inv... 247 8e-64 New sequence mark gi|76259137|ref|ZP_00766788.1| Cell division protein FtsA [Ch... 246 2e-63 New sequence mark gi|66798160|ref|ZP_00396916.1| Cell division protein FtsA [De... 244 7e-63 New sequence mark gi|6458332|gb|AAF10210.1| cell division protein FtsA [Deinoco... 241 3e-62 Gene info New sequence mark gi|77996717|gb|ABB15616.1| cell division protein FtsA [Carbox... 236 1e-60 Gene info New sequence mark gi|42526712|ref|NP_971810.1| cell division protein FtsA [Trep... 234 4e-60 Gene info New sequence mark gi|10175179|dbj|BAB06278.1| cell-division protein (septum for... 233 1e-59 Gene info New sequence mark gi|78170241|gb|ABB27337.1| Cell division protein FtsA [Chloro... 231 4e-59 Gene info New sequence mark gi|88801283|ref|ZP_01116811.1| cell division protein FtsA [Po... 231 5e-59 New sequence mark gi|67938385|ref|ZP_00530911.1| Cell division protein FtsA [Ch... 230 6e-59 New sequence mark gi|46199031|ref|YP_004698.1| cell division protein ftsA [Ther... 230 7e-59 Gene info New sequence mark gi|78167850|gb|ABB24948.1| Cell division protein FtsA [Pelodi... 230 9e-59 Gene info New sequence mark gi|21645923|gb|AAM71279.1| cell division protein FtsA [Chloro... 229 1e-58 Gene info New sequence mark gi|20516649|gb|AAM24842.1| predicted ATPases of the HSP70 cla... 229 2e-58 Gene info New sequence mark gi|57225356|gb|AAW40413.1| cell division protein FtsA [Dehalo... 229 2e-58 Gene info New sequence mark gi|73659908|emb|CAI82515.1| cell division protein FtsA [Dehal... 229 2e-58 Gene info New sequence mark gi|86134324|ref|ZP_01052906.1| cell division protein FtsA [Te... 229 2e-58 New sequence mark gi|55772470|dbj|BAD70911.1| cell division protein FtsA [Therm... 228 3e-58 Gene info New sequence mark gi|57224977|gb|AAW40034.1| cell division protein FtsA [Dehalo... 228 5e-58 Gene info New sequence mark gi|89099617|ref|ZP_01172492.1| cell division protein (septum ... 227 8e-58 New sequence mark gi|68552729|ref|ZP_00592115.1| Cell division protein FtsA [Pr... 227 9e-58 New sequence mark gi|34482388|emb|CAE09389.1| CELL DIVISION PROTEIN FTSA [Wolin... 226 1e-57 Gene info New sequence mark gi|56707352|ref|YP_169248.1| cell division protein FtsA [Fran... 225 3e-57 Gene info New sequence mark gi|89257156|ref|YP_514518.1| cell division protein FtsA [Fran... 225 3e-57 New sequence mark gi|88999609|emb|CAJ75587.1| FTSA protein [Geobacillus thermoleov 224 6e-57 New sequence mark gi|56910362|dbj|BAD64889.1| cell division initiation protein ... 224 6e-57 Gene info New sequence mark gi|46201828|ref|ZP_00054266.2| COG0849: Actin-like ATPase inv... 223 1e-56 New sequence mark gi|67918625|ref|ZP_00512221.1| Cell division protein FtsA [Ch... 223 2e-56 New sequence mark gi|78777491|ref|YP_393806.1| Cell division protein FtsA [Thio... 222 2e-56 Gene info New sequence mark gi|56379501|dbj|BAD75409.1| cell division protein (septum for... 222 3e-56 Gene info New sequence mark gi|88713167|ref|ZP_01107251.1| cell division protein FtsA [Fl... 221 4e-56 New sequence mark gi|2633899|emb|CAB13401.1| cell-division protein [Bacillus su... 221 4e-56 Gene info New sequence mark gi|88806820|ref|ZP_01122336.1| cell division protein FtsA [Ro... 221 4e-56 New sequence mark gi|86132610|ref|ZP_01051203.1| cell division protein FtsA [Ce... 220 7e-56 New sequence mark gi|73660190|emb|CAI82797.1| cell division protein FtsA [Dehal... 220 8e-56 Gene info New sequence mark gi|67934906|ref|ZP_00527931.1| Cell division protein FtsA [Ch... 218 5e-55 New sequence mark gi|68551365|ref|ZP_00590777.1| Cell division protein FtsA [Pe... 218 5e-55 New sequence mark gi|3322667|gb|AAC65373.1| cell division protein (ftsA) [Trepo... 217 7e-55 Gene info New sequence mark gi|76796244|ref|ZP_00778610.1| Cell division protein FtsA [Th... 217 7e-55 New sequence mark gi|86140620|ref|ZP_01059179.1| cell division protein FtsA [Fl... 215 3e-54 New sequence mark gi|89203119|ref|ZP_01181816.1| Cell division protein FtsA [Ba... 214 4e-54 New sequence mark gi|83856722|ref|ZP_00950251.1| Cell division protein FtsA [Cr... 214 4e-54 New sequence mark gi|32262328|gb|AAP77376.1| cell division protein FtsA [Helico... 214 4e-54 Gene info New sequence mark gi|71481296|ref|ZP_00661003.1| Cell division protein FtsA [Pr... 213 1e-53 New sequence mark gi|52348006|gb|AAU40640.1| FtsA [Bacillus licheniformis DSM 1... 213 1e-53 Gene info New sequence mark gi|52003341|gb|AAU23283.1| cell-division protein [Bacillus li... 213 1e-53 Gene info New sequence mark gi|82947793|dbj|BAE52657.1| Actin-like ATPase involved in cel... 213 2e-53 Gene info New sequence mark gi|25527251|gb|AAN04560.1| FtsA [Bacillus mycoides] 211 4e-53 New sequence mark gi|20136385|gb|AAM11651.1| cell division protein FtsA [Azospiril 211 5e-53 New sequence mark gi|49330000|gb|AAT60646.1| cell division protein [Bacillus th... 211 6e-53 Gene info New sequence mark gi|47504487|gb|AAT33163.1| cell division protein FtsA [Bacill... 210 7e-53 Gene info New sequence mark gi|42783000|ref|NP_980247.1| cell division protein FtsA [Baci... 210 8e-53 Gene info New sequence mark gi|51975050|gb|AAU16600.1| cell division protein [Bacillus ce... 210 8e-53 Gene info New sequence mark gi|75762941|ref|ZP_00742744.1| Cell division protein ftsA [Ba... 210 1e-52 New sequence mark gi|29897552|gb|AAP10828.1| Cell division protein ftsA [Bacill... 210 1e-52 Gene info New sequence mark gi|25527233|gb|AAN04556.1| FtsA [Bacillus mycoides] 209 1e-52 New sequence mark gi|22777155|dbj|BAC13428.1| cell-division protein (septum for... 209 2e-52 Gene info New sequence mark gi|83575195|gb|ABC21746.1| Cell division protein FtsA [Rhodos... 208 4e-52 Gene info New sequence mark gi|15075191|emb|CAC46748.1| CELL DIVISION PROTEIN [Sinorhizob... 206 1e-51 Gene info New sequence mark gi|68562889|ref|ZP_00602119.1| Cell division protein FtsA [Ru... 205 2e-51 New sequence mark gi|86358444|ref|YP_470336.1| cell division protein [Rhizobium... 202 2e-50 Gene info New sequence mark gi|29343039|gb|AAO80802.1| cell division protein FtsA [Entero... 202 2e-50 Gene info New sequence mark gi|68196302|gb|EAN10731.1| Cell division protein FtsA [Entero... 202 3e-50 New sequence mark gi|16414653|emb|CAC97369.1| ftsA [Listeria innocua] >gi|16801... 201 4e-50 Gene info New sequence mark gi|2222676|emb|CAA74237.1| ftsA [Enterococcus hirae] >gi|3122... 201 4e-50 New sequence mark gi|49532446|emb|CAG70158.1| cell division protein [Acinetobac... 201 5e-50 Gene info New sequence mark gi|82700243|ref|YP_414817.1| Heat shock protein Hsp70:Cell di... 200 1e-49 Gene info New sequence mark gi|16411503|emb|CAD00111.1| ftsA [Listeria monocytogenes] >gi... 199 1e-49 Gene info New sequence mark gi|46908269|ref|YP_014658.1| cell division protein FtsA [List... 199 1e-49 Gene info New sequence mark gi|23348273|gb|AAN30339.1| cell division protein FtsA [Brucel... 199 2e-49 Gene info New sequence mark gi|2983169|gb|AAC06770.1| cell division protein FtsA [Aquifex... 199 2e-49 Gene info New sequence mark gi|55820800|ref|YP_139242.1| cell division protein [Streptoco... 199 2e-49 Gene info New sequence mark gi|55738686|gb|AAV62327.1| cell division protein [Streptococc... 199 2e-49 Gene info New sequence mark gi|17740547|gb|AAL43078.1| cell division protein [Agrobacteri... 197 6e-49 Gene info New sequence mark gi|88939985|ref|ZP_01145428.1| cell division protein FtsA [Ac... 197 7e-49 New sequence mark gi|74420120|gb|ABA04319.1| Cell division protein FtsA [Nitrob... 195 3e-48 Gene info New sequence mark gi|85714981|ref|ZP_01045966.1| Cell division protein FtsA [Ni... 194 6e-48 New sequence mark gi|56551732|ref|YP_162571.1| cell division protein [Zymomonas... 194 7e-48 Gene info New sequence mark gi|71853845|gb|AAZ51868.1| cell division protein [Streptococc... 193 1e-47 Gene info New sequence mark gi|71490679|gb|EAO23040.1| Cell division protein FtsA [Syntro... 193 1e-47 New sequence mark gi|47779267|gb|AAT38535.1| FtsA [Bartonella bacilliformis] >g... 192 2e-47 New sequence mark gi|14022286|dbj|BAB48896.1| cell division protein; FtsA [Meso... 192 2e-47 Gene info New sequence mark gi|5834365|gb|AAD53931.1| cell division protein FtsA [Zymomonas 191 6e-47 New sequence mark gi|28271635|emb|CAD64541.1| cell division protein FtsA [Lacto... 190 9e-47 Gene info New sequence mark gi|24376927|gb|AAN58293.1| cell division protein FtsA [Strept... 190 1e-46 Gene info New sequence mark gi|27354877|dbj|BAC51862.1| cell division protein [Bradyrhizo... 189 2e-46 Gene info New sequence mark gi|83858910|ref|ZP_00952432.1| FtsA, cell division protein Ft... 189 2e-46 New sequence mark gi|69928979|ref|ZP_00625993.1| Cell division protein FtsA [Ni... 189 2e-46 New sequence mark gi|78698366|ref|ZP_00862869.1| Cell division protein FtsA [Br... 189 2e-46 New sequence mark gi|68193729|gb|EAN08381.1| Cell division protein FtsA [Mesorh... 188 3e-46 New sequence mark gi|77408405|ref|ZP_00785145.1| cell division protein FtsA [St... 188 4e-46 New sequence mark gi|76562339|gb|ABA44923.1| cell division protein FtsA [Strept... 188 4e-46 Gene info New sequence mark gi|23094947|emb|CAD46169.1| ftsA [Streptococcus agalactiae NE... 188 5e-46 Gene info New sequence mark gi|49239955|emb|CAF26360.1| Cell division protein ftsA [Barto... 186 2e-45 Gene info New sequence mark gi|77741184|ref|ZP_00809668.1| Cell division protein FtsA [Rh... 184 4e-45 New sequence mark gi|39650441|emb|CAE28964.1| putative cell division protein Ft... 184 5e-45 Gene info New sequence mark gi|77688127|ref|ZP_00803312.1| Cell division protein FtsA [Rh... 182 2e-44 New sequence mark gi|78493918|ref|ZP_00846149.1| Cell division protein FtsA [Rh... 182 2e-44 New sequence mark gi|81428364|ref|YP_395364.1| Cell division protein, FtsA [Lac... 181 3e-44 Gene info New sequence mark gi|86749126|ref|YP_485622.1| cell division protein FtsA [Rhod... 181 4e-44 Gene info New sequence mark gi|49238658|emb|CAF27904.1| Cell division protein ftsA [Barto... 181 4e-44 Gene info New sequence mark gi|30526099|gb|AAP32281.1| FtsA [Bartonella henselae str. Housto 181 4e-44 New sequence mark gi|15459172|gb|AAL00315.1| Cell division protein FtsA [Strept... 180 1e-43 Gene info New sequence mark gi|68055466|ref|ZP_00539611.1| Cell division protein FtsA [Ex... 179 2e-43 New sequence mark gi|86155593|ref|ZP_01073757.1| cell division protein ftsa [Ca... 179 3e-43 New sequence mark gi|12724902|gb|AAK05968.1| cell division protein FtsA [Lactoc... 178 4e-43 Gene info New sequence mark gi|67927915|ref|ZP_00521105.1| Cell division protein FtsA [So... 178 5e-43 New sequence mark gi|47094597|ref|ZP_00232244.1| cell division protein FtsA [Li... 177 5e-43 New sequence mark gi|47097645|ref|ZP_00235164.1| cell division protein FtsA [Li... 177 8e-43 New sequence mark gi|88597116|ref|ZP_01100352.1| cell division protein FtsA [Ca... 177 9e-43 New sequence mark gi|58001062|gb|AAW59956.1| Cell division protein FtsA [Glucon... 176 1e-42 Gene info New sequence mark gi|57240593|ref|ZP_00368542.1| cell division protein FtsA [Ca... 176 1e-42 New sequence mark gi|62462951|ref|ZP_00382313.1| COG0849: Actin-like ATPase inv... 176 2e-42 New sequence mark gi|57165802|gb|AAW34581.1| cell division protein FtsA [Campyl... 176 2e-42 Gene info New sequence mark gi|6968152|emb|CAB72969.1| cell division protein ftsA [Campyl... 176 2e-42 Gene info New sequence mark gi|89091152|ref|ZP_01164174.1| Cell division protein FtsA [La... 176 2e-42 New sequence mark gi|87305697|ref|ZP_01087851.1| cell division protein FtsA [Ca... 175 3e-42 New sequence mark gi|4138103|emb|CAA75615.1| cell division protein FtsA [Lactococc 175 3e-42 New sequence mark gi|2149908|gb|AAC45638.1| cell division protein [Enterococcus fa 175 3e-42 New sequence mark gi|86137672|ref|ZP_01056249.1| cell division protein FtsA [Ro... 175 4e-42 New sequence mark gi|22533496|gb|AAM99380.1| cell division protein FtsA [Strept... 174 5e-42 Gene info New sequence mark gi|58417221|emb|CAI28334.1| Cell division protein ftsa [Ehrli... 174 5e-42 Gene info New sequence mark gi|57167706|ref|ZP_00366846.1| cell division protein FtsA [Ca... 174 5e-42 New sequence mark gi|57161646|emb|CAH58575.1| cell division protein FtsA [Ehrli... 173 1e-41 Gene info New sequence mark gi|87134841|gb|ABD25583.1| cell division protein FtsA [Novosp... 173 1e-41 Gene info New sequence mark gi|68537378|ref|ZP_00577158.1| Cell division protein FtsA [Sp... 172 2e-41 New sequence mark gi|77387083|gb|ABA78268.1| cell division protein FtsA [Rhodob... 171 6e-41 Gene info New sequence mark gi|28203256|gb|AAO35699.1| cell division protein ftsA [Clostr... 171 6e-41 Gene info New sequence mark gi|83949545|ref|ZP_00958278.1| cell division protein FtsA [Ro... 169 1e-40 New sequence mark gi|84501761|ref|ZP_00999933.1| cell division protein FtsA [Oc... 168 3e-40 New sequence mark gi|83370089|ref|ZP_00914935.1| Cell division protein FtsA [Rh... 168 4e-40 New sequence mark gi|69298116|ref|ZP_00620396.1| Cell division protein FtsA [Si... 168 5e-40 New sequence mark gi|88607356|ref|YP_505720.1| cell division protein FtsA [Anap... 167 6e-40 Gene info New sequence mark gi|88657794|ref|YP_507875.1| cell division protein FtsA [Ehrl... 167 6e-40 Gene info New sequence mark gi|15024656|gb|AAK79658.1| Cell division protein, ftsA [Clost... 167 7e-40 Gene info New sequence mark gi|38570332|gb|AAR24614.1| FtsA [Caulobacter vibrioides] >gi|... 167 1e-39 New sequence mark gi|72394630|gb|AAZ68907.1| Cell division protein FtsA [Ehrlic... 167 1e-39 Gene info New sequence mark gi|48870412|ref|ZP_00323135.1| COG0849: Actin-like ATPase inv... 166 2e-39 New sequence mark gi|85707771|ref|ZP_01038837.1| cell division protein [Erythro... 166 2e-39 New sequence mark gi|56677833|gb|AAV94499.1| cell division protein FtsA [Silici... 165 4e-39 Gene info New sequence mark gi|84686346|ref|ZP_01014240.1| cell division protein FtsA [Rh... 164 6e-39 New sequence mark gi|88607641|ref|YP_505703.1| cell division protein FtsA [Anap... 164 6e-39 Gene info New sequence mark gi|69936397|ref|ZP_00631223.1| Cell division protein FtsA [Pa... 163 1e-38 New sequence mark gi|58698051|ref|ZP_00372975.1| cell division protein FtsA [Wo... 163 1e-38 New sequence mark gi|85703760|ref|ZP_01034864.1| cell division protein FtsA [Ro... 162 2e-38 New sequence mark gi|83953975|ref|ZP_00962696.1| cell division protein FtsA [Su... 162 3e-38 New sequence mark gi|84786274|gb|ABC62456.1| cell division protein [Erythrobact... 162 4e-38 Gene info New sequence mark gi|83942735|ref|ZP_00955196.1| cell division protein FtsA [Su... 161 4e-38 New sequence mark gi|89067820|ref|ZP_01155264.1| cell division protein FtsA [Oc... 161 6e-38 New sequence mark gi|89055242|ref|YP_510693.1| cell division protein FtsA [Jann... 160 8e-38 Gene info New sequence mark gi|51459761|gb|AAU03724.1| cell division protein FtsA [Ricket... 160 1e-37 Gene info New sequence mark gi|42409805|gb|AAS13917.1| cell division protein FtsA [Wolbac... 159 2e-37 Gene info New sequence mark gi|58418689|gb|AAW70704.1| Actin-like ATPase involved in cell... 159 2e-37 Gene info New sequence mark gi|62514808|ref|ZP_00386303.1| COG0849: Actin-like ATPase inv... 159 3e-37 New sequence mark gi|23024799|ref|ZP_00063994.1| COG0849: Actin-like ATPase inv... 158 4e-37 New sequence mark gi|52698638|ref|ZP_00340046.1| COG0849: Actin-like ATPase inv... 158 5e-37 New sequence mark gi|56417148|ref|YP_154222.1| cell division protein FTSA [Anap... 157 7e-37 Gene info New sequence mark gi|67004958|gb|AAY61884.1| Cell division protein FtsA [Ricket... 156 1e-36 Gene info New sequence mark gi|57242051|ref|ZP_00369991.1| cell division protein FtsA [Ca... 156 2e-36 New sequence mark gi|42453475|ref|ZP_00153382.1| COG0849: Actin-like ATPase inv... 155 3e-36 New sequence mark gi|4155486|gb|AAD06487.1| septum formation protein [Helicobac... 155 3e-36 Gene info New sequence mark gi|34580722|ref|ZP_00142202.1| cell division protein ftsA [Ri... 155 4e-36 New sequence mark gi|15645593|ref|NP_207769.1| cell division protein (ftsA) pro... 154 5e-36 Gene info New sequence mark gi|15619397|gb|AAL02873.1| cell division protein ftsA [Ricket... 154 6e-36 Gene info New sequence mark gi|3860813|emb|CAA14713.1| CELL DIVISION PROTEIN FTSA (ftsA) ... 154 8e-36 Gene info New sequence mark gi|51856045|dbj|BAD40203.1| cell division protein FtsA [Symbi... 147 9e-34 Gene info New sequence mark gi|42518899|ref|NP_964829.1| cell division protein FtsA [Lact... 145 3e-33 Gene info New sequence mark gi|52858228|ref|ZP_00046268.2| COG0849: Actin-like ATPase inv... 145 4e-33 New sequence mark gi|67875549|ref|ZP_00504845.1| Cell division protein FtsA [Cl... 141 5e-32 New sequence mark gi|58254437|gb|AAV42674.1| cell division protein [Lactobacill... 134 7e-30 Gene info New sequence mark gi|71364486|ref|ZP_00655074.1| Cell division protein FtsA [Ps... 132 3e-29 New sequence mark gi|71039286|gb|AAZ19594.1| possible cell division protein Fts... 130 1e-28 Gene info New sequence mark gi|62516593|ref|ZP_00387941.1| COG0849: Actin-like ATPase inv... 129 3e-28 New sequence mark gi|88608795|ref|YP_506313.1| cell division protein FtsA [Neor... 128 4e-28 Gene info New sequence mark gi|84516383|ref|ZP_01003742.1| cell division protein FtsA [Lo... 125 4e-27 New sequence mark gi|73662895|ref|YP_301676.1| cell division protein [Staphyloc... 120 1e-25 Gene info New sequence mark gi|57866692|ref|YP_188333.1| cell division protein FtsA [Stap... 119 2e-25 Gene info New sequence mark gi|34763162|ref|ZP_00144129.1| Cell division protein ftsA [Fu... 119 2e-25 New sequence mark gi|57285941|gb|AAW38035.1| cell division protein FtsA [Staphy... 119 2e-25 Gene info New sequence mark gi|49244468|emb|CAG42896.1| putative cell division protein [S... 119 3e-25 Gene info New sequence mark gi|49241477|emb|CAG40163.1| putative cell division protein [S... 119 3e-25 Gene info New sequence mark gi|82750792|ref|YP_416533.1| cell division protein [Staphyloc... 119 3e-25 Gene info New sequence mark gi|27315322|gb|AAO04457.1| cell division protein [Staphylococ... 118 4e-25 Gene info New sequence mark gi|60491278|emb|CAH06026.1| putative cell division protein [B... 117 9e-25 Gene info New sequence mark gi|68447455|dbj|BAE05039.1| cell division protein FtsA [Staph... 117 1e-24 Gene info New sequence mark gi|29340760|gb|AAO78551.1| cell division protein FtsA [Bacter... 115 4e-24 Gene info New sequence mark gi|19715121|gb|AAL95645.1| Cell division protein ftsA [Fusoba... 114 9e-24 Gene info New sequence mark gi|58697043|ref|ZP_00372505.1| cell division protein FtsA [Wo... 110 1e-22 New sequence mark gi|5805059|emb|CAB53636.1| cell division protein [Prevotella alb 105 3e-21 New sequence mark gi|48865796|ref|ZP_00319654.1| COG0849: Actin-like ATPase inv... 104 7e-21 New sequence mark gi|2149897|gb|AAC45628.1| cell division protein [Staphylococc... 97.1 1e-18 New sequence mark gi|53748393|emb|CAH58726.1| hypothetical protein [Clostridium sp 94.4 8e-18 New sequence mark gi|34540392|ref|NP_904871.1| cell division protein FtsA [Porp... 91.7 5e-17 Gene info New sequence mark gi|2209034|dbj|BAA20534.1| FtsA [Porphyromonas gingivalis] 90.9 9e-17 New sequence mark gi|88945441|ref|ZP_01148611.1| Cell division protein FtsA [De... 89.4 3e-16 New sequence mark gi|76795748|ref|ZP_00778120.1| ATPases of the HSP70 class inv... 85.1 4e-15 New sequence mark gi|18145429|dbj|BAB81472.1| cell division protein [Clostridiu... 81.6 5e-14 Gene info New sequence mark gi|1213606|emb|CAA65155.1| ftsA [Campylobacter jejuni] 79.3 3e-13 New sequence mark gi|4981367|gb|AAD35917.1| cell division protein FtsA, putativ... 79.3 3e-13 Gene info New sequence mark gi|20517006|gb|AAM25168.1| predicted ATPases of the HSP70 cla... 78.2 7e-13 Gene info New sequence mark gi|11514422|pdb|1E4G|T Chain T, Ftsa (Atp-Bound Form) From Therm 76.6 2e-12 Related structures New sequence mark gi|82748273|ref|ZP_00910760.1| Cell division protein FtsA [Cl... 76.3 2e-12 New sequence mark gi|57233251|gb|AAW48212.1| cell division protein [Bacillus ce... 74.7 6e-12 New sequence mark gi|37288961|gb|AAQ90691.1| cell division protein [Bacillus sp. A 73.6 1e-11 New sequence mark gi|1196309|gb|AAB51401.1| putative [Borrelia burgdorferi] 72.4 3e-11 New sequence mark gi|88946774|ref|ZP_01149842.1| FTSA related protein, predicte... 68.9 3e-10 New sequence mark gi|4981835|gb|AAD36352.1| cell division protein FtsA, putativ... 65.5 4e-09 Gene info New sequence mark gi|77684791|ref|ZP_00800211.1| cell division protein FtsA [Al... 64.3 9e-09 New sequence mark gi|83573000|gb|ABC19552.1| Cell division protein FtsA [Moorel... 63.5 2e-08 Gene info New sequence mark gi|82746397|ref|ZP_00908904.1| FTSA related protein, predicte... 62.4 4e-08 New sequence mark gi|77995664|gb|ABB14563.1| putative cell division protein Fts... 62.0 5e-08 Gene info New sequence mark gi|51856548|dbj|BAD40706.1| cell division protein [Symbiobact... 61.6 6e-08 Gene info New sequence mark gi|1518098|gb|AAC24602.1| ATP binding protein [Azotobacter vinel 59.3 3e-07 New sequence mark gi|22777913|dbj|BAC14184.1| cell division protein [Oceanobaci... 58.2 7e-07 Gene info New sequence mark gi|15023923|gb|AAK78989.1| FTSA related protein, predicted AT... 57.8 8e-07 Gene info New sequence mark gi|89211486|ref|ZP_01189849.1| cell division protein [Halothe... 57.0 1e-06 New sequence mark gi|89100109|ref|ZP_01172978.1| cell division protein [Bacillu... 56.2 2e-06 New sequence mark gi|86143874|ref|ZP_01062242.1| putative rod-shape determining... 52.8 3e-05 New sequence mark gi|86131552|ref|ZP_01050150.1| putative rod-shape determining... 52.8 3e-05 New sequence mark gi|88804968|ref|ZP_01120488.1| cell shape-determining protein... 52.8 3e-05 New sequence mark gi|77545815|gb|ABA89377.1| type IV pilus biogenesis protein P... 52.4 3e-05 Gene info New sequence mark gi|88713395|ref|ZP_01107478.1| cell shape-determining protein... 52.4 3e-05 New sequence mark gi|28203129|gb|AAO35572.1| cell division protein ftsA [Clostr... 52.4 4e-05 Gene info New sequence mark gi|83855534|ref|ZP_00949063.1| putative rod-shape determining... 51.6 6e-05 New sequence mark gi|77995890|gb|ABB14789.1| type IV pilus assembly protein Pil... 51.2 9e-05 Gene info New sequence mark gi|10175866|dbj|BAB06962.1| cell division protein [Bacillus h... 49.7 2e-04 Gene info New sequence mark gi|10173458|dbj|BAB04562.1| cell-shape determining protein [B... 49.3 3e-04 Gene info New sequence mark gi|88931676|ref|ZP_01137369.1| Type IV pilus assembly protein... 48.9 4e-04 New sequence mark gi|10802652|gb|AAG23549.1| cell division protein [Carboxydotherm 48.5 5e-04 New sequence mark gi|48856970|ref|ZP_00311127.1| COG1077: Actin-like ATPase inv... 48.5 5e-04 New sequence mark gi|86135264|ref|ZP_01053845.1| rod shape-determining protein ... 48.1 6e-04 New sequence mark gi|67874083|ref|ZP_00503988.1| Cell shape determining protein... 47.4 0.001 New sequence mark gi|28271738|emb|CAD64644.1| cell shape determining protein Mr... 47.4 0.001 Gene info New sequence mark gi|15645983|ref|NP_208164.1| rod shape-determining protein (m... 47.0 0.001 Gene info New sequence mark gi|48865225|ref|ZP_00319088.1| COG1077: Actin-like ATPase inv... 47.0 0.002 New sequence mark gi|20515898|gb|AAM24154.1| HSP70 class molecular chaperones i... 46.6 0.002 Gene info New sequence mark gi|82501400|ref|ZP_00886735.1| Cell shape determining protein... 46.6 0.002 New sequence mark gi|88802127|ref|ZP_01117655.1| putative rod-shape determining... 46.2 0.003 New sequence mark gi|21646479|gb|AAM71789.1| rod shape-determining protein MreB... 45.8 0.003 Gene info New sequence mark gi|39984020|gb|AAR35408.1| type IV pilus biogenesis protein P... 45.8 0.004 Gene info New sequence mark gi|82497275|ref|ZP_00882832.1| Type IV pilus assembly protein... 45.4 0.004 New sequence mark gi|2920363|gb|AAC04558.1| rod shape-determining protein [Helicob 45.4 0.005
Sequences with E-value WORSE than threshold
  gi|4155891|gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN [Heli... 45.1 0.005 Gene info   gi|48864869|ref|ZP_00318740.1| COG1077: Actin-like ATPase inv... 45.1 0.006   gi|78166339|gb|ABB23437.1| Cell shape determining protein Mre... 45.1 0.006 Gene info   gi|82744312|ref|ZP_00906885.1| Type IV pilus assembly protein... 44.7 0.007   gi|62513118|ref|ZP_00384687.1| COG1077: Actin-like ATPase inv... 44.7 0.007   gi|78688068|ref|ZP_00852792.1| Type IV pilus assembly protein... 44.7 0.008   gi|84787068|gb|ABC63250.1| ATPase [Erythrobacter litoralis HT... 44.7 0.008 Gene info   gi|68545226|ref|ZP_00584777.1| Type IV pilus assembly protein... 44.3 0.009   gi|17981534|gb|AAL51058.1| MreB3 [Spiroplasma citri] 44.3 0.009   gi|67938212|ref|ZP_00530741.1| Cell shape determining protein... 44.3 0.009   gi|24371879|ref|NP_715921.1| type IV pilus biogenesis protein... 44.3 0.009 Gene info   gi|15024168|gb|AAK79214.1| mreB [Clostridium acetobutylicum A... 44.3 0.010 Gene info   gi|28202514|gb|AAO34959.1| rod shape-determining protein mreB... 43.9 0.013 Gene info   gi|16415205|emb|CAC97895.1| mbl [Listeria innocua] >gi|168017... 43.9 0.013 Gene info   gi|71481009|ref|ZP_00660718.1| Cell shape determining protein... 43.9 0.013   gi|89200295|ref|ZP_01179049.1| Cell shape determining protein... 43.5 0.014   gi|68212572|ref|ZP_00564408.1| Type IV pilus assembly protein... 43.5 0.014   gi|89211274|ref|ZP_01189646.1| similar to Actin-like ATPase i... 43.5 0.016   gi|83647996|ref|YP_436431.1| Actin-like ATPase involved in ce... 43.5 0.017 Gene info   gi|67919641|ref|ZP_00513211.1| Cell shape determining protein... 43.5 0.017   gi|33632181|emb|CAE06637.1| Rod shape determining protein [Sy... 43.5 0.017 Gene info   gi|72002887|gb|AAZ58689.1| Cell shape determining protein Mre... 43.1 0.020 Gene info   gi|76795769|ref|ZP_00778140.1| Cell shape determining protein... 43.1 0.020   gi|34541078|ref|NP_905557.1| cell shape-determining protein M... 43.1 0.022 Gene info   gi|68553241|ref|ZP_00592620.1| Cell shape determining protein... 43.1 0.022   gi|42518887|ref|NP_964817.1| rod shape-determining protein Mr... 43.1 0.023 Gene info   gi|71063173|gb|AAZ22176.1| rod shape-determining protein MreB... 42.7 0.025 Gene info   gi|47094417|ref|ZP_00232105.1| mbl protein [Listeria monocyto... 42.7 0.025   gi|29898085|gb|AAP11359.1| Rod shape-determining protein mreB... 42.7 0.026 Gene info   gi|49332970|gb|AAT63616.1| rod shape-determining protein [Bac... 42.7 0.026 Gene info   gi|89205253|ref|ZP_01183824.1| Cell shape determining protein... 42.7 0.026   gi|29341129|gb|AAO78918.1| rod shape-determining protein MreB... 42.7 0.027 Gene info   gi|76876508|emb|CAI87730.1| Rod shape-determining protein [Ps... 42.7 0.030 Gene info   gi|17978911|gb|AAL49988.1| cell shape-determining protein [Spiro 42.7 0.031   gi|77997004|gb|ABB15903.1| cell shape-determining protein Mre... 42.4 0.034 Gene info   gi|33640528|emb|CAE20317.1| Rod shape determining protein [Pr... 42.4 0.036 Gene info   gi|87135825|gb|ABD26567.1| cell shape determining protein, Mr... 42.4 0.038 Gene info   gi|52003259|gb|AAU23201.1| cell-shape determining protein [Ba... 42.4 0.039 Gene info   gi|10175653|dbj|BAB06750.1| cell-shape determining protein [B... 42.4 0.039 Gene info   gi|68553473|ref|ZP_00592847.1| Cell shape determining protein... 42.4 0.041   gi|17981535|gb|AAL51059.1| MreB4 [Spiroplasma citri] 42.0 0.045   gi|46908697|ref|YP_015086.1| mbl protein [Listeria monocytoge... 42.0 0.045 Gene info   gi|62513431|ref|ZP_00384980.1| COG1077: Actin-like ATPase inv... 42.0 0.045   gi|23003788|ref|ZP_00047434.1| COG1077: Actin-like ATPase inv... 42.0 0.047   gi|22294661|dbj|BAC08490.1| rod shape-determining protein [Th... 42.0 0.049 Gene info   gi|6983753|emb|CAB75392.1| rod shape-determining protein [Str... 42.0 0.052 Gene info   gi|78171455|gb|ABB28551.1| Cell shape determining protein Mre... 42.0 0.052 Gene info   gi|60494787|emb|CAH09593.1| putative rod-shape determining pr... 42.0 0.052 Gene info   gi|20515151|gb|AAM23472.1| HSP70 class molecular chaperones i... 42.0 0.055 Gene info   gi|87301691|ref|ZP_01084531.1| Rod shape determining protein ... 41.6 0.056   gi|29831998|ref|NP_826632.1| rod shape-determining protein [S... 41.6 0.056 Gene info   gi|82747507|ref|ZP_00910003.1| Cell shape determining protein... 41.6 0.058   gi|56380994|dbj|BAD76902.1| cell-shape determining protein [G... 41.6 0.060 Gene info   gi|2633818|emb|CAB13320.1| cell-shape determining protein [Ba... 41.6 0.066 Gene info   gi|88704052|ref|ZP_01101767.1| rod shape-determining protein ... 41.6 0.068   gi|68562579|ref|ZP_00601831.1| Type IV pilus assembly protein... 41.2 0.072   gi|86154632|ref|ZP_01072799.1| cell shape-determining protein... 41.2 0.073   gi|58254426|gb|AAV42663.1| rod shape-determining protein [Lac... 41.2 0.075 Gene info   gi|88808219|ref|ZP_01123730.1| cell shape determining protein... 41.2 0.077   gi|67936809|ref|ZP_00529804.1| Cell shape determining protein... 41.2 0.082   gi|33238762|gb|AAQ00827.1| Actin-like ATPase [Prochlorococcus... 41.2 0.084 Gene info   gi|68232387|ref|ZP_00571536.1| Cell shape determining protein... 41.2 0.086   gi|66044489|ref|YP_234330.1| chaperone protein HscA [Pseudomo... 41.2 0.089 Gene info   gi|22778646|dbj|BAC14914.1| cell shape determining protein (F... 41.2 0.091 Gene info   gi|78196116|gb|ABB33881.1| cell shape determining protein, Mr... 41.2 0.093 Gene info   gi|68550277|ref|ZP_00589729.1| Cell shape determining protein... 40.8 0.11   gi|85686149|ref|ZP_01032693.1| COG1077: Actin-like ATPase inv... 40.8 0.11   gi|55773198|dbj|BAD71639.1| rod shape-determining protein Mre... 40.8 0.11 Gene info   gi|34482225|emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING PR... 40.8 0.12 Gene info   gi|51854931|dbj|BAD39089.1| cell shape determining protein [S... 40.8 0.12 Gene info   gi|71845473|gb|AAZ44969.1| Type IV pilus assembly protein Pil... 40.4 0.12 Gene info   gi|42518868|ref|NP_964798.1| MreB-like protein [Lactobacillus... 40.4 0.13 Gene info   gi|17981533|gb|AAL51057.1| MreB2 [Spiroplasma citri] 40.4 0.13   gi|33634396|emb|CAE20081.1| Rod shape determining protein [Pr... 40.4 0.13 Gene info   gi|86157069|ref|YP_463854.1| type IV pilus assembly protein P... 40.4 0.13 Gene info   gi|78168027|gb|ABB25124.1| Cell shape determining protein Mre... 40.4 0.13 Gene info   gi|67986074|gb|EAM73909.1| Type IV pilus assembly protein Pil... 40.4 0.13   gi|85708575|ref|ZP_01039641.1| ATPase [Erythrobacter sp. NAP1... 40.4 0.13   gi|82499412|ref|ZP_00884858.1| Cell shape determining protein... 40.4 0.14   gi|32262734|gb|AAP77781.1| rod shape-determining protein MreB... 40.4 0.14 Gene info   gi|71556423|gb|AAZ35634.1| Fe-S protein assembly chaperone Hs... 40.4 0.14 Gene info   gi|77996348|gb|ABB15247.1| Mbl protein [Carboxydothermus hydr... 40.4 0.14 Gene info   gi|89211696|ref|ZP_01190047.1| Cell shape determining protein... 40.4 0.14   gi|33148595|gb|AAP96114.1| rod shape-determining protein MreB... 40.4 0.14 Gene info   gi|30181038|emb|CAD86228.1| putative type 4 fimbrial biogenes... 40.4 0.15 Gene info   gi|56909283|dbj|BAD63810.1| cell-shape determining protein [B... 40.0 0.16 Gene info   gi|2688645|gb|AAC67059.1| rod shape-determining protein (mreB... 40.0 0.16 Gene info   gi|78193446|gb|ABB31213.1| Type IV pilus assembly protein Pil... 40.0 0.17 Gene info   gi|76795951|ref|ZP_00778321.1| Cell shape determining protein... 40.0 0.17   gi|19712791|gb|AAL93692.1| Rod shape-determining protein mreB... 40.0 0.17 Gene info   gi|67916663|ref|ZP_00510364.1| Type IV pilus assembly protein... 40.0 0.17   gi|84701496|ref|ZP_01016071.1| rod shape-determining protein ... 40.0 0.17   gi|34762387|ref|ZP_00143389.1| Rod shape-determining protein ... 40.0 0.18   gi|89098969|ref|ZP_01171849.1| cell-shape determining protein... 40.0 0.18   gi|46400647|emb|CAF24096.1| probable rod shape-determining pr... 40.0 0.18 Gene info   gi|23024393|ref|ZP_00063606.1| COG1077: Actin-like ATPase inv... 40.0 0.19   gi|89090783|ref|ZP_01163821.1| Cell shape determining protein... 40.0 0.19   gi|87123226|ref|ZP_01079077.1| Rod shape determining protein ... 40.0 0.20   gi|4982111|gb|AAD36611.1| rod shape-determining protein MreB ... 39.7 0.21 Gene info   gi|81428463|ref|YP_395463.1| Cell shape determining protein M... 39.7 0.22 Gene info   gi|85858467|ref|YP_460669.1| rod shape-determining protein [S... 39.7 0.22 Gene info   gi|51573538|gb|AAU07563.1| rod shape-determining protein [Bor... 39.7 0.24 Gene info   gi|84519064|ref|ZP_01006413.1| Actin-like ATPase [Prochloroco... 39.7 0.24   gi|87120473|ref|ZP_01076367.1| rod shape-determining protein ... 39.7 0.25   gi|75432720|ref|ZP_00733132.1| hSP70 class molecular chaperon... 39.7 0.25   gi|2983387|gb|AAC06972.1| rod shape determining protein MreB ... 39.7 0.26 Gene info   gi|88936657|ref|ZP_01142260.1| Type IV pilus assembly protein... 39.7 0.27   gi|77544737|gb|ABA88299.1| rod shape-determining protein MreB... 39.7 0.27 Gene info   gi|85713051|ref|ZP_01044088.1| Actin-like ATPase [Idiomarina ... 39.3 0.28   gi|56381710|dbj|BAD77618.1| cell shape determining protein (M... 39.3 0.29 Gene info   gi|56911845|dbj|BAD66372.1| cell shape determining protein [B... 39.3 0.30 Gene info   gi|67940469|ref|ZP_00532880.1| Cell shape determining protein... 39.3 0.31   gi|18145845|dbj|BAB81886.1| cell shape determining protein [C... 39.3 0.32 Gene info   gi|51855199|dbj|BAD39357.1| cell shape determining protein [S... 39.3 0.32 Gene info   gi|89210196|ref|ZP_01188588.1| Cell shape determining protein... 39.3 0.32   gi|86609926|ref|YP_478688.1| rod shape-determining protein [C... 39.3 0.33 Gene info   gi|88858676|ref|ZP_01133317.1| Rod shape-determining protein ... 39.3 0.33   gi|78713599|gb|ABB50776.1| cell shape determining protein, Mr... 39.3 0.34 Gene info   gi|7190117|gb|AAF38963.1| cell shape-determining protein MreB... 39.3 0.34 Gene info   gi|28808885|dbj|BAC61993.1| heat shock protein 70 family prot... 39.3 0.34 Gene info   gi|33236721|gb|AAP98808.1| rod shape-determining protein [Chl... 39.3 0.34 Gene info   gi|23002573|ref|ZP_00046248.1| COG1077: Actin-like ATPase inv... 39.3 0.34   gi|29835022|gb|AAP05656.1| cell shape-determining protein Mre... 39.3 0.35 Gene info
Alignments
>gi|78100129|sp|P0ABH3|FTSA_SHIFL Cell division protein ftsA Length=439 Score = 823 bits (2127), Expect = 0.0, Method: Composition-based stats. Identities = 420/420 (100%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|24050298|gb|AAN41756.1| Gene info ATP-binding cell division protein [Shigella flexneri 2a str. 301] gi|1786282|gb|AAC73205.1| Gene info ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli K12] gi|74310713|ref|YP_309132.1| Gene info ATP-binding cell division protein [Shigella sonnei Ss046] gi|82775501|ref|YP_401848.1| Gene info ATP-binding cell division protein [Shigella dysenteriae Sd197] gi|89106977|ref|AP_000757.1| ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli W3110] gi|26106424|gb|AAN78610.1| Gene info Cell division protein ftsA [Escherichia coli CFT073] gi|21321975|dbj|BAB96662.1| ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli W3110] gi|40862|emb|CAA38871.1| FtsA protein [Escherichia coli] gi|30039903|gb|AAP15637.1| Gene info ATP-binding cell division protein [Shigella flexneri 2a str. 2457T] gi|82542698|ref|YP_406645.1| Gene info ATP-binding cell division protein [Shigella boydii Sb227] gi|13359554|dbj|BAB33521.1| Gene info ATP-binding cell division protein FtsA [Escherichia coli O157:H7] gi|30061661|ref|NP_835832.1| Gene info cell division protein [Shigella flexneri 2a str. 2457T] gi|24111539|ref|NP_706049.1| Gene info cell division protein [Shigella flexneri 2a str. 301] gi|16128087|ref|NP_414636.1| Gene info cell division protein [Escherichia coli K12] gi|15829352|ref|NP_308125.1| Gene info cell division protein [Escherichia coli O157:H7] gi|78100128|sp|P0ABH0|FTSA_ECOLI Cell division protein ftsA gi|78100127|sp|P0ABH1|FTSA_ECOL6 Cell division protein ftsA gi|78100126|sp|P0ABH2|FTSA_ECO57 Gene info Cell division protein ftsA gi|12512800|gb|AAG54398.1| Gene info ATP-binding cell division protein, septation process, complexes with FtsZ, associated with junctions of inner and outer membranes [Escherichia coli O157:H7 EDL933] gi|26246027|ref|NP_752066.1| Gene info cell division protein [Escherichia coli CFT073] gi|15799778|ref|NP_285790.1| Gene info cell division protein [Escherichia coli O157:H7 EDL933] gi|81239649|gb|ABB60359.1| Gene info ATP-binding cell division protein [Shigella dysenteriae Sd197] gi|75511682|ref|ZP_00734320.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli 53638] gi|75256034|ref|ZP_00727747.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E22] gi|75236012|ref|ZP_00720148.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli F11] gi|75229057|ref|ZP_00715637.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli B7A] gi|75209385|ref|ZP_00709617.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli B171] gi|75194311|ref|ZP_00704381.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli HS] gi|75189194|ref|ZP_00702461.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E24377A] gi|81244109|gb|ABB64817.1| Gene info ATP-binding cell division protein [Shigella boydii Sb227] gi|83585184|ref|ZP_00923834.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli 101-1] gi|73854190|gb|AAZ86897.1| Gene info ATP-binding cell division protein [Shigella sonnei Ss046] Length=420 Score = 818 bits (2113), Expect = 0.0, Method: Composition-based stats. Identities = 420/420 (100%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|146032|gb|AAA23817.1| FtsA [Escherichia coli] gi|146025|gb|AAA23811.1| cell division protein Length=420 Score = 816 bits (2108), Expect = 0.0, Method: Composition-based stats. Identities = 419/420 (99%), Positives = 419/420 (99%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGA QIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGARQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|16418632|gb|AAL19096.1| Gene info ATP-binding cell division protein [Salmonella typhimurium LT2] gi|16501417|emb|CAD01289.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Typhi] gi|62178699|ref|YP_215116.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|56126661|gb|AAV76167.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|29136301|gb|AAO67868.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Typhi Ty2] gi|62126332|gb|AAX64035.1| Gene info ATP-binding cell division protein, septation process, complexes with FtsZ, associated with junctions of inner and outer membranes [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|16763522|ref|NP_459137.1| Gene info cell division protein [Salmonella typhimurium LT2] gi|56412404|ref|YP_149479.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|16759127|ref|NP_454744.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29140677|ref|NP_804019.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] gi|25300218|pir||AI0518 cell division protein FtsA [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) Length=420 Score = 795 bits (2053), Expect = 0.0, Method: Composition-based stats. Identities = 418/420 (99%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|85058430|ref|YP_454132.1| Gene info cell division protein FtsA [Sodalis glossinidius str. 'morsitans'] gi|84778950|dbj|BAE73727.1| Gene info cell division protein FtsA [Sodalis glossinidius str. 'morsitans'] Length=418 Score = 776 bits (2005), Expect = 0.0, Method: Composition-based stats. Identities = 393/420 (93%), Positives = 407/420 (96%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMD+AVYT GALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDMAVYTAGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALG++V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGAVVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+EILQLQE+LR QGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG Sbjct 301 YTELLNLVNDEILQLQEQLRAQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQ PYYSTAVGLLHYGKESHL+GE +VEKR SV +W KR + WLRKEF Sbjct 361 PLNITGLTDYAQAPYYSTAVGLLHYGKESHLSGEVDVEKR--TSVSTWFKRFSGWLRKEF 418 >gi|75175651|ref|ZP_00695859.1| COG0849: Actin-like ATPase involved in cell division [Shigella boydii BS512] Length=399 Score = 770 bits (1989), Expect = 0.0, Method: Composition-based stats. Identities = 399/399 (100%), Positives = 399/399 (100%), Gaps = 0/399 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK 399 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK 399 >gi|45438226|gb|AAS63773.1| Gene info cell division protein FtsA [Yersinia pestis biovar Medievalis str. 91001] gi|21960593|gb|AAM87170.1| Gene info ATP-binding cell division protein [Yersinia pestis KIM] gi|51588324|emb|CAH19932.1| Gene info cell division protein FtsA [Yersinia pseudotuberculosis IP 32953] gi|15978651|emb|CAC89415.1| Gene info cell division protein FtsA [Yersinia pestis CO92] gi|22127496|ref|NP_670919.1| Gene info cell division protein [Yersinia pestis KIM] gi|51595042|ref|YP_069233.1| Gene info cell division protein [Yersinia pseudotuberculosis IP 32953] gi|45443357|ref|NP_994896.1| Gene info cell division protein [Yersinia pestis biovar Medievalis str. 91001] gi|16120887|ref|NP_404200.1| Gene info cell division protein [Yersinia pestis CO92] gi|89102560|ref|ZP_01175184.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pestis biovar Orientalis str. IP275] gi|77977548|ref|ZP_00832993.1| COG0849: Actin-like ATPase involved in cell division [Yersinia intermedia ATCC 29909] gi|77976096|ref|ZP_00831629.1| COG0849: Actin-like ATPase involved in cell division [Yersinia frederiksenii ATCC 33641] gi|77962102|ref|ZP_00825927.1| COG0849: Actin-like ATPase involved in cell division [Yersinia mollaretii ATCC 43969] gi|77958231|ref|ZP_00822268.1| COG0849: Actin-like ATPase involved in cell division [Yersinia bercovieri ATCC 43970] gi|77633647|ref|ZP_00795769.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pestis Angola] gi|77631672|ref|ZP_00794258.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pseudotuberculosis IP 31758] Length=418 Score = 767 bits (1981), Expect = 0.0, Method: Composition-based stats. Identities = 399/420 (95%), Positives = 413/420 (98%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG Sbjct 301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR ASVG+W KR+NSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418 >gi|36786949|emb|CAE16023.1| Gene info cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] gi|37527514|ref|NP_930858.1| Gene info cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] Length=418 Score = 767 bits (1980), Expect = 0.0, Method: Composition-based stats. Identities = 384/420 (91%), Positives = 405/420 (96%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKV+ALVGE+LPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVSALVGEILPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDV+NVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVDNVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDE+R+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNI KAVERCGL Sbjct 121 VRDEYRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIAKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIF+GLA+SY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFSGLAASYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAE IKVRHGCALGS+V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAETIKVRHGCALGSLVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELLNLVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GLA CAQRVFH QVRIG Sbjct 301 YIELLNLVNDEILRLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLAECAQRVFHAQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQ+PYYSTAVGLLHYGK SHLNG+A++EK V SV W KR++SWL+KEF Sbjct 361 PLNITGLTDYAQQPYYSTAVGLLHYGKASHLNGDADIEKHV--SVSRWFKRVSSWLKKEF 418 >gi|49613259|emb|CAG76710.1| Gene info cell division protein [Erwinia carotovora subsp. atroseptica SCRI1043] gi|50122733|ref|YP_051900.1| Gene info cell division protein [Erwinia carotovora subsp. atroseptica SCRI1043] Length=418 Score = 763 bits (1969), Expect = 0.0, Method: Composition-based stats. Identities = 399/420 (95%), Positives = 413/420 (98%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQ+DVE+VVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQDDVESVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALG+IVGKDE+VEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGAIVGKDENVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+E+LQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG Sbjct 301 YTELLNLVNDELLQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+NITGLTDYAQEPYYSTAVGLLHYGKESHL GE EVEKR ASV +W KR+NSWLRKEF Sbjct 361 PMNITGLTDYAQEPYYSTAVGLLHYGKESHLGGEHEVEKR--ASVSNWFKRINSWLRKEF 418 >gi|71796038|gb|AAZ40789.1| Gene info cell division protein [Candidatus Blochmannia pennsylvanicus str. BPEN] gi|71891932|ref|YP_277662.1| Gene info cell division protein [Candidatus Blochmannia pennsylvanicus str. BPEN] Length=418 Score = 666 bits (1718), Expect = 0.0, Method: Composition-based stats. Identities = 331/420 (78%), Positives = 384/420 (91%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKA+D+KL+VGLEIGTAKVA ++GE+LPDG+VN+IG+G CPSRGMDKGGVN+LESV+KC Sbjct 1 MIKASDKKLLVGLEIGTAKVATMIGEILPDGIVNVIGLGYCPSRGMDKGGVNNLESVIKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQ +I+QAELMA CQISSVYL+LSGKHISC+NEIGMVPISEEEVTQ DV+NVVH AKSVR Sbjct 61 VQYSINQAELMAGCQISSVYLSLSGKHISCKNEIGMVPISEEEVTQSDVDNVVHIAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF+GLASS++VLTEDERELGVCVVD+GGGTMDIA+YT GALRHTKVIPYAGNVVT Sbjct 181 QVDQLIFSGLASSHAVLTEDERELGVCVVDLGGGTMDIAIYTAGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP SDAE IKVR+GCAL S++ K E++EVPSVGGRPPR LQR LAE+IEPR Sbjct 241 SDIAYAFGTPLSDAEIIKVRYGCALESLISKGENIEVPSVGGRPPRILQRHMLAEIIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL+ LVN+EILQLQ +LRQ +KHHLAAGIVLTGGA+ I+GL+ACAQ+VFHTQVRI + Sbjct 301 YIELMMLVNKEILQLQSQLRQLNIKHHLAAGIVLTGGASLIDGLSACAQKVFHTQVRIAS 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +N G+TD + P+YST +GLLHYGKESHLN E ++EK +T + WI+++N+WL+KEF Sbjct 361 SINTNGVTDDIKRPHYSTVIGLLHYGKESHLNNEVDIEKGIT--IKGWIRKVNNWLKKEF 418 >gi|46914741|emb|CAG21518.1| Gene info putative cell division protein FtsA [Photobacterium profundum SS9] gi|54310300|ref|YP_131320.1| Gene info cell division protein [Photobacterium profundum SS9] Length=418 Score = 641 bits (1653), Expect = 0.0, Method: Composition-based stats. Identities = 314/420 (74%), Positives = 368/420 (87%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D+KL+VGL+IGT+KV ALVGEVLPDG VN+IGVGS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADKKLIVGLDIGTSKVCALVGEVLPDGNVNVIGVGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQISSVYL+LSGKHISCQ E GMVPIS++EVTQ+DV+NV+HTAKSV+ Sbjct 61 VQRAVDQAELMADCQISSVYLSLSGKHISCQTEKGMVPISDKEVTQDDVDNVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DEHR LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMA+NIVKAVERCGL Sbjct 121 ISDEHRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMARNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD LIF+GLA+S++VLT DERELGVCVVDIGGGTMD+AV++GGALRH +VIPYAGNVVT Sbjct 181 KVDHLIFSGLAASHAVLTPDERELGVCVVDIGGGTMDLAVWSGGALRHAEVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP DAE IKV++GCAL +V KD V+VPSVGGRP RSLQ QTLAEVIEPR Sbjct 241 SDIAYAFGTPLGDAEEIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN++++ +Q+++R GVKHHLAAGIVLTGGA+Q+EGL CA+RVF QVRIG Sbjct 301 YSELLGLVNQKLIDIQDQMRDAGVKHHLAAGIVLTGGASQMEGLIECAERVFRNQVRIGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GLTDY Q P+++TAVGLLHYGK+S ++++E + SV R++ W +KEF Sbjct 361 PLELNGLTDYVQAPHFATAVGLLHYGKDSQAFDDSDIEPK--RSVSGLFARISGWFKKEF 418 >gi|25166158|dbj|BAC24349.1| Gene info ftsA [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|32490952|ref|NP_871206.1| Gene info cell division protein [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length=418 Score = 641 bits (1653), Expect = 0.0, Method: Composition-based stats. Identities = 305/419 (72%), Positives = 374/419 (89%), Gaps = 1/419 (0%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 +KATD+KLVVGLEIGT+KVA LVG++L DG+V IIG G+ PS+G+DKGGVNDLE+VV+CV Sbjct 1 MKATDKKLVVGLEIGTSKVAVLVGDILQDGIVKIIGYGNYPSKGIDKGGVNDLEAVVQCV 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 Q++I+QAEL ++C I SVYLALSGKHISCQNEIG+VPI EEEVTQEDVENVVHTAKSVR+ Sbjct 61 QQSINQAELTSECNIKSVYLALSGKHISCQNEIGIVPIPEEEVTQEDVENVVHTAKSVRI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 ++EHR+LHVIPQEY IDYQEGIKNP+GLSG+RMQA VHLITCHN MAKN++KAV RC +K Sbjct 121 KNEHRILHVIPQEYTIDYQEGIKNPIGLSGIRMQASVHLITCHNGMAKNMIKAVRRCDVK 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 VDQ+IF+GLASSY+VLTEDE+ELGVCVVDIGGGTMDIA+YT GALRHTKVIPYAGNVVT Sbjct 181 VDQVIFSGLASSYAVLTEDEKELGVCVVDIGGGTMDIAIYTAGALRHTKVIPYAGNVVTR 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIAYAFGTPP +AE+IK+ +GCALGS+V K+E++E+ S+GGRP R LQRQTL+EVIEPRY Sbjct 241 DIAYAFGTPPIEAESIKINYGCALGSLVKKEENIEIASLGGRPSRILQRQTLSEVIEPRY 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 ELLNLV +E+ +LQ++L+ + +KHHL+AGIVLTGGA+QI G+ +CAQ++F+TQVRIG P Sbjct 301 IELLNLVKKEVCKLQKQLKSESIKHHLSAGIVLTGGASQINGIISCAQKIFNTQVRIGEP 360 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 LN+TGL DY+ PYY+TAVGLLHYGKE LN E E ++ + +WIK+ ++W++KEF Sbjct 361 LNVTGLIDYSNHPYYATAVGLLHYGKEYFLNKEIESMEK-NNFIENWIKKFSNWIKKEF 418 >gi|89074167|ref|ZP_01160666.1| cell division protein [Photobacterium sp. SKA34] gi|89050103|gb|EAR55629.1| cell division protein [Photobacterium sp. SKA34] Length=418 Score = 639 bits (1649), Expect = 0.0, Method: Composition-based stats. Identities = 319/420 (75%), Positives = 367/420 (87%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D+KL+VGL+IGT++V ALVGEVLPD VN+IG+GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADQKLIVGLDIGTSEVTALVGEVLPDNTVNVIGMGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+D+AELMA+CQISSVYL+LSGKHISCQ E GMVPISE+EVTQ+DV+NV+HTAKSV+ Sbjct 61 VQRAVDKAELMAECQISSVYLSLSGKHISCQTEKGMVPISEKEVTQDDVDNVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMAKNIVKAVERC L Sbjct 121 LSDEQRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMAKNIVKAVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD LIF+GLASSY+VLT DERELGVCVVDIGGGTMD+A+++GGALRH +VIPYAGNVVT Sbjct 181 KVDHLIFSGLASSYAVLTPDERELGVCVVDIGGGTMDLAIWSGGALRHAEVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP DAE IKV++GCAL +V KD V+VPSVGGRP RSLQ QTLAEVIEPR Sbjct 241 SDIAYAFGTPPGDAEDIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN+++L +QE+LR+ GVKHHLAAGIVLTGGAAQ+EGL CA+RVF QVRIG Sbjct 301 YSELLGLVNQKLLTVQEQLREAGVKHHLAAGIVLTGGAAQMEGLTECAERVFRHQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY Q P Y+TAVGLLHYGK+S E E+E + SV R++ WL+KEF Sbjct 361 PLELSGLTDYVQAPTYATAVGLLHYGKDSQSFDENELEPK--RSVTGLFSRISGWLKKEF 418 >gi|75234331|ref|ZP_00718709.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E110019] Length=324 Score = 624 bits (1609), Expect = 2e-177, Method: Composition-based stats. Identities = 324/324 (100%), Positives = 324/324 (100%), Gaps = 0/324 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGV 324 YTELLNLVNEEILQLQEKLRQQGV Sbjct 301 YTELLNLVNEEILQLQEKLRQQGV 324 >gi|33517282|emb|CAD83666.1| Gene info cell division protein FtsA [Candidatus Blochmannia floridanus] gi|33519619|ref|NP_878451.1| Gene info cell division protein [Candidatus Blochmannia floridanus] Length=420 Score = 621 bits (1602), Expect = 1e-176, Method: Composition-based stats. Identities = 311/422 (73%), Positives = 371/422 (87%), Gaps = 4/422 (0%) Query 1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 MIK +D +KL+VGLEIGTAKVA L+GE+LPD M+NIIG+G C S+GMDKGGVN+LESV+K Sbjct 1 MIKVSDNKKLLVGLEIGTAKVATLIGEILPDSMINIIGMGCCASQGMDKGGVNNLESVIK 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 CV+ +I+QAE M+ CQI+SVYL+LSGKHISC+NEIGMV ISEEEVTQ DV+NVVH AKSV Sbjct 61 CVEYSINQAESMSGCQITSVYLSLSGKHISCKNEIGMVSISEEEVTQSDVDNVVHIAKSV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 ++ DEHR+LHVIPQ+Y+IDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG Sbjct 121 KMSDEHRILHVIPQDYSIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VDQLIF+GL+SSY+VLT+DERELGVCVVD+GGGTMDIA+YT GALR+ KVIPYAGNVV Sbjct 181 LRVDQLIFSGLSSSYAVLTQDERELGVCVVDLGGGTMDIAIYTAGALRYIKVIPYAGNVV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 TSDIAYAFGTP S AE+IK+R+GCAL S+V +DE++EVPSVGGRPPR LQR LAE+IEP Sbjct 241 TSDIAYAFGTPLSAAESIKLRYGCALESLVDRDENIEVPSVGGRPPRILQRYMLAEIIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY EL+NLVN+EILQLQ +L+Q +KHHLAAG+VLTGGA+ I+GL ACAQ+VFH QVRI Sbjct 301 RYVELMNLVNKEILQLQSQLKQFNIKHHLAAGVVLTGGASMIDGLVACAQKVFHNQVRIA 360 Query 360 APLNITG-LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 + +NI G + D + P YST +GLLHYGKESHLN + + + +WIK++N WL+K Sbjct 361 SSINILGSIDDDIRGPQYSTVIGLLHYGKESHLN--DDADIDKKIKIKNWIKKINGWLKK 418 Query 419 EF 420 EF Sbjct 419 EF 420 >gi|9656971|gb|AAF95541.1| Gene info cell division protein FtsA [Vibrio cholerae O1 biovar eltor str. N16961] gi|15642395|ref|NP_232028.1| Gene info cell division protein [Vibrio cholerae O1 biovar eltor str. N16961] gi|75829632|ref|ZP_00758929.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae MO10] gi|75827665|ref|ZP_00757100.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae O395] gi|75818129|ref|ZP_00748341.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae V51] gi|75816053|ref|ZP_00746536.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae V52] Length=420 Score = 604 bits (1558), Expect = 2e-171, Method: Composition-based stats. Identities = 289/420 (68%), Positives = 361/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLITCHNDMA+NI+KAVERCGL Sbjct 121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTEL+ LVN+ + +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF QVR+G Sbjct 301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++ S+ WI RL +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420 >gi|28805446|dbj|BAC58726.1| Gene info cell division protein FtsA [Vibrio parahaemolyticus RIMD 2210633] gi|28897237|ref|NP_796842.1| Gene info cell division protein [Vibrio parahaemolyticus RIMD 2210633] Length=420 Score = 597 bits (1539), Expect = 3e-169, Method: Composition-based stats. Identities = 286/420 (68%), Positives = 359/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISRVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR++G+KHHLAAG+VLTGGAAQI+G+ CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIDSVQAKLREEGIKHHLAAGVVLTGGAAQIDGVVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + +SV + +L +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDMQSSDDSDYNEPKRSSVTGFFDKLRNWIQKEF 420 >gi|75853564|ref|ZP_00761381.1| COG0849: Actin-like ATPase involved in cell division [Vibrio sp. Ex25] Length=420 Score = 596 bits (1537), Expect = 6e-169, Method: Composition-based stats. Identities = 286/420 (68%), Positives = 359/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D ++VGL+IGTA V+ALVGEVLPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADDNIIVGLDIGTATVSALVGEVLPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISRVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR++G+KHHLAAG+VLTGGAAQ++G+ CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIDSVQAKLREEGIKHHLAAGVVLTGGAAQMDGVIECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + +SV + +L +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDMQSSDDSDYNEPKRSSVTGFFDKLRNWIQKEF 420 >gi|37197542|dbj|BAC93381.1| Gene info cell division protein FtsA [Vibrio vulnificus YJ016] gi|37678801|ref|NP_933410.1| Gene info cell division protein [Vibrio vulnificus YJ016] Length=445 Score = 593 bits (1528), Expect = 6e-168, Method: Composition-based stats. Identities = 284/420 (67%), Positives = 357/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 26 MTKTADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 85 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+CQIS+V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 86 VQRAIDQAEMMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 145 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 146 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 205 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+Q++F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 206 KVEQIVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 265 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 266 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 325 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR+ G+KHHLAAG+VLTGGAAQIEGL CA+RVF QVR+G Sbjct 326 YSELMGLVNQTIESVQMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGK 385 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + ++V +L +W++KEF Sbjct 386 PLEVSGLTDYVKEPYHSTAVGLLHYARDMRSSDDSDYNEPKRSAVTGLFGKLRNWIQKEF 445 >gi|59712804|ref|YP_205580.1| Gene info cell division protein [Vibrio fischeri ES114] gi|59480905|gb|AAW86692.1| Gene info cell division protein FtsA [Vibrio fischeri ES114] Length=420 Score = 590 bits (1522), Expect = 3e-167, Method: Composition-based stats. Identities = 288/420 (68%), Positives = 356/420 (84%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + ++VGL+IGT KV+ALVGEVLPDG V++IG GSCPSRGMDKGGVNDLESVVK Sbjct 1 MSKTPEGSIIVGLDIGTNKVSALVGEVLPDGQVSVIGSGSCPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+C I+SV+++LSGKHI+ Q E GM ISEEEVTQ+D+++V+HTAKSV+ Sbjct 61 VQRAIDQAELMAECTITSVFISLSGKHIASQIEKGMGSISEEEVTQDDMDSVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R LHVIPQE++ID Q+GI+NP+GLSG+RM+ VHLITCHNDMA+NIVKAVERCGL Sbjct 121 IGDEQRTLHVIPQEFSIDVQKGIRNPIGLSGMRMEVSVHLITCHNDMARNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+ +IF+GLASS +V+TEDER+LGVCVVDIG GTMDIA++T G+LRH +V+PYAGN VT Sbjct 181 KVEHIIFSGLASSNAVITEDERDLGVCVVDIGAGTMDIAIWTDGSLRHAEVLPYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP +DAE +KV++GCA+ + +DE+V VPSVGGRP RSLQR+ LAEVIEPR Sbjct 241 SDIAYAFGTPFNDAEKLKVKYGCAISEHINRDETVNVPSVGGRPSRSLQRRMLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN+ I+ +Q++LR +G KHHLAAGIVLTGG +QIEGL CA+RVF TQVRIG Sbjct 301 YSELLGLVNQRIVSIQDQLRAEGTKHHLAAGIVLTGGGSQIEGLVDCAERVFQTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL +TGLTDY +EPY +TAVGLLHYGKES L+ + + + S + IK+ +W+ KEF Sbjct 361 PLEVTGLTDYVKEPYQATAVGLLHYGKESQLHDDEDYVPSKSQSFTTVIKKFKNWILKEF 420 >gi|86148543|ref|ZP_01066830.1| cell division protein [Vibrio sp. MED222] gi|85833689|gb|EAQ51860.1| cell division protein [Vibrio sp. MED222] gi|84394642|ref|ZP_00993335.1| cell division protein FtsA [Vibrio splendidus 12B01] gi|84374735|gb|EAP91689.1| cell division protein FtsA [Vibrio splendidus 12B01] Length=422 Score = 589 bits (1519), Expect = 6e-167, Method: Composition-based stats. Identities = 284/422 (67%), Positives = 354/422 (83%), Gaps = 2/422 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA ++ALVGE+LPDG +NIIG G PSRGMDKGGVNDLESVVK Sbjct 1 MTKTADDNIIVGLDIGTATISALVGEILPDGQINIIGSGQSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS+V+++LSGKHI+ + E GM IS+EEV+Q+D++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQDDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CH+DMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHSDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V+Q++F+GLASS +V+T+DERELGVCVVDIG GTMDI+++TGGALRHT+V YAGN VT Sbjct 181 TVEQIVFSGLASSNAVITDDERELGVCVVDIGAGTMDISIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV HGCAL +V KD+SV VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVNHGCALSELVSKDDSVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTEL+ LVN+ I +Q +LR +G+KHHLAAG+VLTGGAAQI+GL CA+RVF QVR+G Sbjct 301 YTELMGLVNQTIDTVQLQLRDEGIKHHLAAGVVLTGGAAQIDGLVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVE--KRVTASVGSWIKRLNSWLRK 418 PL ++GLTDY +EPY+STAVGLLHY ++ ++ E + KR S+ +L +W++K Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDCQISDEGDYSEPKRSAPSMSGLFGKLRNWIQK 420 Query 419 EF 420 EF Sbjct 421 EF 422 >gi|27360153|gb|AAO09091.1| Gene info Cell division protein FtsA [Vibrio vulnificus CMCP6] gi|27364036|ref|NP_759564.1| Gene info cell division protein [Vibrio vulnificus CMCP6] Length=433 Score = 577 bits (1488), Expect = 3e-163, Method: Composition-based stats. Identities = 278/388 (71%), Positives = 340/388 (87%), Gaps = 0/388 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKTADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+CQIS+V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAEMMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+Q++F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQIVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR+ G+KHHLAAG+VLTGGAAQIEGL CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIESVQMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKE 388 PL ++GLTDY +EPY+STAVGLLHY ++ Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARD 388 >gi|71145113|gb|AAZ25586.1| Gene info cell division protein FtsA [Colwellia psychrerythraea 34H] gi|71279373|ref|YP_271109.1| Gene info cell division protein FtsA [Colwellia psychrerythraea 34H] Length=411 Score = 516 bits (1328), Expect = 9e-145, Method: Composition-based stats. Identities = 253/420 (60%), Positives = 329/420 (78%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA +RKLVVGL+IGT+K++ VGE+ PD ++IIGVG+ P+RGMDKGGVNDL V++ Sbjct 1 MSKAAERKLVVGLDIGTSKISVAVGEITPDNQLSIIGVGNQPARGMDKGGVNDLNLVIQA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMADCQISS+YL +SGKHISCQNE GMVPI+++EV QEDV+NV+HTA+SV Sbjct 61 IQRAINEAELMADCQISSIYLGISGKHISCQNENGMVPINDKEVIQEDVDNVIHTARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY+ID Q+GIK+P+G+SGVRM+AKVH++TC NDMAKN+VK VERC L Sbjct 121 ISAERRMLHVLPQEYSIDCQDGIKSPIGMSGVRMEAKVHIVTCANDMAKNLVKCVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DE+ELGVCVVD+G GTMDI+V+TGG LRHT VIP AGN VT Sbjct 181 TADQLIFSALASSYAVLTDDEKELGVCVVDMGAGTMDISVFTGGTLRHTAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDI+ F TP S AE IKV++ CAL +V +ES++VPSVGGRP RS+ R TL+EV+EPR Sbjct 241 SDISKIFRTPLSHAEDIKVQYACALKQLVSMEESIDVPSVGGRPARSMSRHTLSEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ +EI R+ G++ +AAG VLTGG A++EG+ A+ +F VRI Sbjct 301 YQELFELIQDEI-------RESGLEDQIAAGYVLTGGTAKMEGVLEFAEEIFQMPVRIAN 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL++ GL +Y +P YST VGLLHYG ++ + +KR SVG + R+++W + EF Sbjct 354 PLSVQGLKEYVNDPTYSTVVGLLHYGMQATSEVNSSAKKR--ESVGDFWSRIHAWFKGEF 411 >gi|82742141|ref|ZP_00904843.1| Cell division protein FtsA [Shewanella sp. W3-18-1] gi|82720475|gb|EAP55339.1| Cell division protein FtsA [Shewanella sp. W3-18-1] Length=411 Score = 512 bits (1318), Expect = 1e-143, Method: Composition-based stats. Identities = 256/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL I GL +Y + YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPIKGLYEYVDQSIYSTGVGLLHYGARRVL--ERQFERPERQGVTSAWNRVQSWFKGEF 411 >gi|24375701|ref|NP_719744.1| Gene info cell division protein FtsA [Shewanella oneidensis MR-1] gi|24350633|gb|AAN57188.1| Gene info cell division protein FtsA [Shewanella oneidensis MR-1] gi|78691050|ref|ZP_00855682.1| Cell division protein FtsA [Shewanella sp. MR-7] gi|78509574|gb|EAP22964.1| Cell division protein FtsA [Shewanella sp. MR-7] Length=411 Score = 511 bits (1316), Expect = 2e-143, Method: Composition-based stats. Identities = 255/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y + YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLYEYVDQSIYSTGVGLLHYGARRVL--ERQFERPERQGVTSAWNRVQSWFKGEF 411 >gi|68547969|ref|ZP_00587491.1| Cell division protein FtsA [Shewanella amazonensis SB2B] gi|68514300|gb|EAN38039.1| Cell division protein FtsA [Shewanella amazonensis SB2B] Length=411 Score = 507 bits (1306), Expect = 3e-142, Method: Composition-based stats. Identities = 254/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGTAKVAA++GEV+PDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTAKVAAIIGEVMPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVY+++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYMSISGKHIACQNERGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID QEGI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQEGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DI VYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTNDEKDLGVCLVDIGGGTTDITVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 NDIAKIFRTPLSHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR ++ +AAGIVLTGG A IEG A+ VF VR+ + Sbjct 301 YQELFELVLKE-------LRSARLEDQIAAGIVLTGGTASIEGAVDVAEAVFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ + GL +Y +P YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PMPVKGLYEYVDQPIYSTGVGLLHYGARRVL--ERQYERPQRQGVTSVWNRVQSWFKGEF 411 >gi|69951271|ref|ZP_00639012.1| Cell division protein FtsA [Shewanella frigidimarina NCIMB 400] gi|69165035|gb|EAN74065.1| Cell division protein FtsA [Shewanella frigidimarina NCIMB 400] Length=411 Score = 506 bits (1302), Expect = 8e-142, Method: Composition-based stats. Identities = 251/420 (59%), Positives = 325/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT+KVA ++GEVLPDG +++IG+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQERNLIVGLDIGTSKVAVIIGEVLPDGEISVIGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY+ID Q+GIK+P+G+SG+RM+AK H++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYSIDVQDGIKSPIGMSGMRMEAKAHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ SVLT DE++LGVC+VDIGGGT DIAVYT GALRH VIP AGN VT Sbjct 181 KVDDLVFSGIASADSVLTNDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP + AE IKV+ A S V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 SDIAKIFRTPLTHAEQIKVQFASARSSTVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV ++L+ G++ +AAGIVLTGG + I G A+ F VR+ + Sbjct 301 YQELFELV-------LKQLQDSGLEDQIAAGIVLTGGTSSISGAVEIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST +GLLHYG + E + E+ V S++ R+ SW + EF Sbjct 354 PLPVKGLYEYVDQPIYSTGIGLLHYGARRVI--ERQFERPERQGVTSFLNRVKSWFKGEF 411 >gi|78368229|ref|ZP_00838470.1| Cell division protein FtsA [Shewanella sp. PV-4] gi|78359686|gb|EAP01540.1| Cell division protein FtsA [Shewanella sp. PV-4] Length=411 Score = 504 bits (1299), Expect = 2e-141, Method: Composition-based stats. Identities = 251/420 (59%), Positives = 323/420 (76%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++++G+GS PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGSHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ++SVYL +SGKHI CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVASVYLGISGKHIQCQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+ +AS+ +VLT+DE++LGVC+VD+GGGT DI +YT GALRH V+P AGN VT Sbjct 181 KVDDLVFSAIASADAVLTDDEKDLGVCLVDMGGGTTDITIYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 SDIAKIFRTPLSHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR G++ +AAGIVLTGG A IEG A+ F VR+ Sbjct 301 YQELFELVRKE-------LRDCGLEDQVAAGIVLTGGTASIEGAVDVAEATFGMPVRVAE 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLFEYVNQPIYSTGVGLLHYGARRVL--ERQFERPERQGVTSLWNRVQSWFKGEF 411 >gi|21623112|gb|AAM67771.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Sg (Schizaphis graminum)] gi|22654234|sp|O51928|FTSA_BUCAP Cell division protein ftsA gi|21672493|ref|NP_660560.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Sg (Schizaphis graminum)] Length=418 Score = 501 bits (1290), Expect = 2e-140, Method: Composition-based stats. Identities = 241/420 (57%), Positives = 332/420 (79%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + +RKLVVGLEIGT KV LVGEVL +G + IIG+G C S G+DKG +N+L++V+ C Sbjct 1 MIISKNRKLVVGLEIGTTKVVTLVGEVLTNGKIKIIGIGICQSNGIDKGRINNLDAVISC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++ +I QAE+MA+CQI+SVYL+LS K+I+CQNEIG+VPISE+EVT+ED+ENV+HTAKSV+ Sbjct 61 IRESIHQAEIMANCQITSVYLSLSSKYINCQNEIGIVPISEDEVTKEDIENVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSG RMQ +VHLITCH +MAKNI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQSGIKNPIGLSGTRMQVRVHLITCHQNMAKNIIKAVEKCDI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE +LGVC++DIGGGT+D+ Y G+++ ++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECKLGVCMIDIGGGTIDLITYIDGSIQDSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DI+YAF T SD+E IK+++G A+ G +++++ S G ++LQ+ T+ EVIE R Sbjct 241 KDISYAFSTSYSDSEKIKIKYGSAIKLSPGTSKNIDLSSKYGNFQKNLQQDTVIEVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+L+N IL +Q+KL ++G K+ L GIVLTGGA+ I L CA+++F ++RI Sbjct 301 YNELLHLINNRILYVQKKLYKEGRKYQLTGGIVLTGGASTISFLTECAEKIFQKKIRIAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNI+GLTD EP+YST VGLLHYGKE + + +KR + + W +++++W +KEF Sbjct 361 PLNISGLTDNVTEPHYSTVVGLLHYGKEFYFDDTN--QKREISFIEKWFQKISNWFKKEF 418 >gi|82495625|ref|ZP_00881199.1| Cell division protein FtsA [Shewanella sp. MR-4] gi|82406217|gb|EAP46883.1| Cell division protein FtsA [Shewanella sp. MR-4] Length=393 Score = 500 bits (1288), Expect = 4e-140, Method: Composition-based stats. Identities = 248/400 (62%), Positives = 318/400 (79%), Gaps = 7/400 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKR 400 PL + GL +Y + YST VGLLHYG L + E +R Sbjct 354 PLPVKGLYEYVDQSIYSTGVGLLHYGARRVLERQFERPER 393 >gi|85712529|ref|ZP_01043577.1| Cell division ATPase, FtsA [Idiomarina baltica OS145] gi|85693663|gb|EAQ31613.1| Cell division ATPase, FtsA [Idiomarina baltica OS145] Length=410 Score = 500 bits (1288), Expect = 4e-140, Method: Composition-based stats. Identities = 251/420 (59%), Positives = 324/420 (77%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K T+R++VVGL+IGT+KV ALVGE+LPD +++IGVG +RGMDKGGVNDL VV+ Sbjct 1 MSKTTERQMVVGLDIGTSKVTALVGELLPDDDISVIGVGVTTARGMDKGGVNDLNLVVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+D+AELMADC+I+SVYL +SG+HISCQNE GMVP++E EVTQ+DV+NV+H A+SV Sbjct 61 IQRAVDEAELMADCRIASVYLNISGRHISCQNESGMVPVNEAEVTQDDVDNVIHAAQSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY ID QE I++P+G+SGVRM++KVH+ITC NDMAKNI KAVERCGL Sbjct 121 IAKERRILHVLPQEYVIDSQESIRSPIGMSGVRMESKVHIITCANDMAKNITKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+LIF+ LASS SVLT+DE++LGV +VD+GGGT+DI +Y GG LRHT VIP AGN VT Sbjct 181 QVDKLIFSALASSISVLTDDEKDLGVALVDMGGGTIDICIYAGGVLRHTAVIPAAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP + AE IK H CAL +V ++++EVPSVGGRP R + R TLAEV+EPR Sbjct 241 SDIAKIFRTPTNHAEQIKTEHACALRGLVSMEDTIEVPSVGGRPARMMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV EEI+ Q G+ +AAG+VLTGG+A+++G A+ +F VRIG Sbjct 301 YQELFELVREEIV-------QSGLDEQVAAGVVLTGGSAKMQGCIEFAEEIFQMPVRIGK 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL+I GL DY ++P Y+TAVGLL YG+E + E K T +G W ++L +W + EF Sbjct 354 PLHIKGLKDYVEDPVYATAVGLLKYGQEDATASQQESSK--TDVIGMW-QKLQNWFKGEF 410 >gi|68543485|ref|ZP_00583188.1| Cell division protein FtsA [Shewanella baltica OS155] gi|68518789|gb|EAN42347.1| Cell division protein FtsA [Shewanella baltica OS155] Length=407 Score = 500 bits (1287), Expect = 4e-140, Method: Composition-based stats. Identities = 249/400 (62%), Positives = 319/400 (79%), Gaps = 7/400 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MIKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKR 400 PL I GL +Y + YST VGLLHYG + + E +R Sbjct 354 PLPIKGLYEYVDQSIYSTGVGLLHYGARRVIERQFERPER 393 >gi|2738588|gb|AAC46068.1| cell division protein [Buchnera aphidicola] Length=418 Score = 499 bits (1286), Expect = 6e-140, Method: Composition-based stats. Identities = 240/420 (57%), Positives = 331/420 (78%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + +RKLVVGLEIGT KV LVGEVL +G + IIG+G C S G+DKG +NDL++V+ C Sbjct 1 MIISKNRKLVVGLEIGTTKVVTLVGEVLTNGKIKIIGIGICQSNGIDKGRINDLDAVISC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++ +I QAE+MA+CQI+SVYL+LS K+I+C NEIG+VPISE+EVT+ED+ENV+HTAKSV+ Sbjct 61 IRESIHQAEIMANCQITSVYLSLSSKYINCPNEIGIVPISEDEVTKEDIENVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSG RMQ +VHLITCH +MAKNI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQSGIKNPIGLSGTRMQVRVHLITCHQNMAKNIIKAVEKCDI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE +LGVC++DIGGGT+D+ Y G+++ ++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECKLGVCMIDIGGGTIDLITYIDGSIQDSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DI+YAF T SD+E IK+++G A+ G +++++ S G ++LQ+ T+ EVI+ R Sbjct 241 KDISYAFSTSYSDSEKIKIKYGSAIKLSPGTSKNIDLSSKYGNFQKNLQQDTVIEVIDSR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+L+N IL +Q+KL ++G K+ L GIVLTGGA+ I L CA+++F ++RI Sbjct 301 YNELLHLINNRILYVQKKLYKEGRKYQLTGGIVLTGGASTISFLTECAEKIFQKKIRIAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNI+GLTD EP+YST VGLLHYGKE + + +KR + + W +++++W +KEF Sbjct 361 PLNISGLTDNVTEPHYSTVVGLLHYGKEFYFDDTN--QKREISFIEKWFQKISNWFKKEF 418 >gi|11761338|dbj|BAB19205.1| FtsA [Shewanella violacea] Length=411 Score = 499 bits (1284), Expect = 1e-139, Method: Composition-based stats. Identities = 249/420 (59%), Positives = 319/420 (75%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++++G+G+ SRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGTHQSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL +SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLGISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+ IK P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDSIKGPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+ +AS+ SVLT DE++LGVC+VDIGGGT DI VYT GALRH VIP AGN VT Sbjct 181 KVDDLVFSAIASADSVLTNDEKDLGVCLVDIGGGTTDITVYTNGALRHCAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP + AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 NDIAKIFRTPLAHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR G++ +AAGIVLTGG + IEG A+ F VR+ Sbjct 301 YQELFELVLKE-------LRDSGLEDQVAAGIVLTGGTSSIEGAVDVAEATFGMPVRVAN 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST +GLLHYG E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLFEYVDQPIYSTGIGLLHYGARRLF--ERQFERPERQGVTSLWNRVQSWFKGEF 411 >gi|10038895|dbj|BAB12930.1| Gene info cell division protein ftsA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] gi|15616832|ref|NP_240044.1| Gene info cell division protein FtsA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] gi|11132267|sp|P57309|FTSA_BUCAI Cell division protein ftsA gi|25300213|pir||B84955 cell division protein ftsA [imported] - Buchnera sp. (strain APS) Length=418 Score = 497 bits (1279), Expect = 4e-139, Method: Composition-based stats. Identities = 234/420 (55%), Positives = 327/420 (77%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + DRKLVVGLEIGT KV LVGEVL D + IIG G+C S+G+DKG +N+L+ +V C Sbjct 1 MIISKDRKLVVGLEIGTTKVVTLVGEVLIDDNIKIIGFGTCLSKGIDKGKINNLDLIVSC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +Q +I++AE+MADCQI+SVYL+LS K+I+CQNEIG++PIS++EVT+ED+E+V+H A+SV+ Sbjct 61 IQESINKAEIMADCQITSVYLSLSNKYINCQNEIGIIPISDDEVTKEDIEHVIHIAQSVQ 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSGVRMQ KVHLITCH +MA+NI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQYGIKNPIGLSGVRMQVKVHLITCHQNMARNIIKAVEKCDV 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE LGVC++DIGGGT+D +Y G++++++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECNLGVCMIDIGGGTIDFTIYIDGSIKYSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDI+YAF T +AE IK+++G +G ++++ + ++LQ+ L +VIE R Sbjct 241 SDISYAFSTSRDNAENIKIKYGSVKKPPLGSSKNIDFSDINCNFQQNLQQDALIDVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+LV ++I+ LQ+KL ++G K+ L +GIVLTGG + I L CA++VF +VR+ Sbjct 301 YVELLSLVQDQIVHLQKKLHKKGEKYELLSGIVLTGGGSNISCLTDCAEKVFQKKVRVAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P NI+GL + EP YST +GLLHYGKES++N + +K+ + KR+N+W +KEF Sbjct 361 PFNISGLIEKITEPCYSTVIGLLHYGKESYIN--IDKKKKEHSFFEIIFKRINNWFKKEF 418 >gi|76794187|ref|ZP_00776661.1| Cell division protein FtsA [Pseudoalteromonas atlantica T6c] gi|76590483|gb|EAO66699.1| Cell division protein FtsA [Pseudoalteromonas atlantica T6c] Length=409 Score = 494 bits (1271), Expect = 4e-138, Method: Composition-based stats. Identities = 250/420 (59%), Positives = 325/420 (77%), Gaps = 11/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K TDRKL+VGL+IGT+ V A+VGE+L DG +++IGVGS PS+GMDKGGVNDL VV+ Sbjct 1 MSKVTDRKLIVGLDIGTSMVKAVVGELLDDGGISVIGVGSHPSKGMDKGGVNDLNLVVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+ + ELMADC++SSV++++SG+H+ CQNE GMVPI+ +EVTQEDV+NV+H A+SV Sbjct 61 VQRAMSEMELMADCRVSSVFMSISGRHVQCQNESGMVPINNKEVTQEDVDNVIHAARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQE+ ID QEGIKNP+G+SGVRM+A+ H+ITC +DMAKN+VK VERC L Sbjct 121 IAAERRLLHVLPQEFTIDVQEGIKNPIGMSGVRMEAQAHIITCADDMAKNLVKCVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DE+ELGVCVVDIGGGT+DI +YT GA+RHT V+P AGN +T Sbjct 181 TTDQLIFSSLASSYAVLTDDEKELGVCVVDIGGGTIDIVIYTDGAIRHTAVVPAAGNQIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S AE IK+ + CAL +V +E++EV SVGGRP R++ R TLAEVIEPR Sbjct 241 SDIAKIFRTPISHAEDIKINYACALKDMVSMEENIEVHSVGGRPSRAMSRHTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +EI R G + +AAGIVLTGG A++EG A+ +F VR+G Sbjct 301 YQELFELVQKEI-------RNSGFEEQIAAGIVLTGGTAKMEGAIEFAEEIFQMPVRVGE 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL+I GL++Y ++P ++TA+GLL YGKE H+ A+ + AS G W +R+ SW + EF Sbjct 354 PLSIKGLSEYVEDPTFATAIGLLQYGKE-HI--TAKTAAKTKASEGVW-ERIQSWFKGEF 409 >gi|56178561|gb|AAV81283.1| Gene info Cell division ATPase, FtsA [Idiomarina loihiensis L2TR] gi|56459551|ref|YP_154832.1| Gene info Cell division ATPase, FtsA [Idiomarina loihiensis L2TR] Length=402 Score = 491 bits (1263), Expect = 3e-137, Method: Composition-based stats. Identities = 244/412 (59%), Positives = 319/412 (77%), Gaps = 10/412 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT+KV AL+GE+LPD ++++GVG+ SRGMDKGGVNDL VV+ VQRA+D+A Sbjct 1 MVVGLDIGTSKVTALIGELLPDNEISVVGVGTATSRGMDKGGVNDLNLVVQSVQRAVDEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMADC+++SVYL +SG+HISCQNE GMVPI+E EVTQ+DV++V+H A+SV + E R+L Sbjct 61 ELMADCRVASVYLNISGRHISCQNESGMVPINEAEVTQDDVDSVIHAAQSVPIAKERRIL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQEY ID QE I++P+G+SGVRM++KVH+ITC NDMAKNI+KAVERCGL VD+LIF+ Sbjct 121 HVLPQEYVIDSQESIRSPIGMSGVRMESKVHIITCANDMAKNIIKAVERCGLSVDKLIFS 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS SVLT+DE++LGV +VD+GGGT+DI +Y GG LRHT VIP AGN VTSDIA F Sbjct 181 ALASSISVLTDDEKDLGVALVDLGGGTIDICIYAGGVLRHTAVIPAAGNQVTSDIAKIFR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP + AE IK +H CAL +V ++++EVPSVGGRP R + R TLAEV+EPRY EL LV Sbjct 241 TPTNHAEEIKTKHACALRQMVSMEDTIEVPSVGGRPSRVMSRHTLAEVVEPRYQELFELV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +EI +Q G+ +AAG+V+TGG+A++EG A+ +F VRIG PL + GL Sbjct 301 RDEI-------QQSGLDEQIAAGVVITGGSAKMEGCVDFAEEIFQMPVRIGVPLGMKGLR 353 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 DY ++P Y+TAVGLL YG+E + E K T +G W +++ SW + EF Sbjct 354 DYVEDPVYATAVGLLRYGQEDAAVSQKESSK--TDVIGLW-QKVQSWFKGEF 402 >gi|27904093|gb|AAO26927.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Bp (Baizongia pistaciae)] gi|38372214|sp|Q89AQ4|FTSA_BUCBP Cell division protein ftsA gi|27904696|ref|NP_777822.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Bp (Baizongia pistaciae)] Length=421 Score = 470 bits (1209), Expect = 5e-131, Method: Composition-based stats. Identities = 229/427 (53%), Positives = 311/427 (72%), Gaps = 13/427 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK +KL+VGLEIGT K VGE+L D +NIIG+G S G+D+G +NDL+S+V+C Sbjct 1 MIKVLKKKLIVGLEIGTTKTTISVGEILEDDTINIIGIGLSKSIGIDRGIINDLKSIVEC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +++ I+QAE MA+C I+S+YLALS K+I+CQNEIG++PI +EE+T+ D+ENV+HTAKSVR Sbjct 61 IKKVINQAETMANCNITSIYLALSNKYINCQNEIGIIPILQEEITKNDIENVIHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 +R+EH++LH+IPQEY+ID + GIKNP+GLSG+RMQA VHLITCH+ + KNI+KAVE CG+ Sbjct 121 IRNEHKILHIIPQEYSIDERTGIKNPIGLSGIRMQAIVHLITCHSSIKKNIIKAVESCGI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +F+GLASS SVLT DER LGVC+VDIGGGT DIA+YT G L+H+ VIPYAGN VT Sbjct 181 RVDYSVFSGLASSESVLTTDERNLGVCIVDIGGGTTDIAIYTNGTLKHSCVIPYAGNTVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DI+Y F P AE IK+++G A+ S +E +++ + ++ + L EVIE R Sbjct 241 NDISYVFNIPFMYAEKIKIKYGYAMQSSDITEEEIKIVNEDNTIIQTFHKDKLTEVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL L+NEEI Q+KL++ G H L AGIVLTGGA+ I+ CA++VF+ VRIG Sbjct 301 YIELLTLINEEIKNTQKKLKKSGRIHKLGAGIVLTGGASNIKLFKNCAEKVFNIPVRIGC 360 Query 361 P----LNITGLTDYAQEPYYSTAVGLLHYGKE---SHLNGEAEVEKRVTASVGSWIKRLN 413 P +N LT+ Q ST +GLL++GK+ SH N K W++ +N Sbjct 361 PKKNNINTAKLTNNTQTGSLSTVIGLLYFGKKYFYSHRN------KNSYNFFKKWLQYIN 414 Query 414 SWLRKEF 420 +W++KEF Sbjct 415 NWIKKEF 421 >gi|76876326|emb|CAI87548.1| Gene info Cell division protein [Pseudoalteromonas haloplanktis TAC125] gi|77361415|ref|YP_340990.1| Gene info Cell division protein [Pseudoalteromonas haloplanktis TAC125] Length=410 Score = 468 bits (1205), Expect = 1e-130, Method: Composition-based stats. Identities = 235/420 (55%), Positives = 307/420 (73%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K+ +R LV+GL++GT+KV A VGE+ D ++I+GVG+ SRGMDKGGVNDL V + Sbjct 1 MTKSAERNLVIGLDVGTSKVIATVGEITADNKLSIVGVGTQISRGMDKGGVNDLNLVSES 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++RAID+AELMADC+ISSVYL +SGKHI CQNE G+V I+ EVT ED+ENV+H A+SV Sbjct 61 IRRAIDEAELMADCRISSVYLGISGKHIQCQNESGVVAINNTEVTDEDIENVIHIARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E ++LH +PQEY+ID QEGIKNP+G+SGVRM+A+ H+ITC NDMAKNI K V+RCGL Sbjct 121 ISAERKMLHALPQEYSIDMQEGIKNPLGMSGVRMEARAHIITCSNDMAKNIEKCVQRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF LAS YSVLT+DE+ELGV V+DIGGGTMDI +Y GALRH+ VIP AGN VT Sbjct 181 EVDQLIFTALASCYSVLTDDEKELGVAVLDIGGGTMDITIYINGALRHSAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DIA F TP S AEA+KV++ CA + ++++EVPSVGGRP R + R TL+EV+EPR Sbjct 241 GDIAKIFRTPISHAEALKVQYACASSQMASNEDTIEVPSVGGRPARLMSRHTLSEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 + EL L EEI R+ G++ +AAG+V+TGG A++ G A+ +F VRIG Sbjct 301 FRELFELAMEEI-------RRSGLEDQIAAGLVITGGTAKMAGAMEVAEDIFQMPVRIGK 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ I GLTDY +P Y+TAVGLL YG+ +++ ++ S R+ W + EF Sbjct 354 PIGIVGLTDYVDDPSYATAVGLLQYGRTMQSMNAQKLKAEGNNNLWS---RITKWFQGEF 410 >gi|88858806|ref|ZP_01133447.1| Cell division protein [Pseudoalteromonas tunicata D2] gi|88819032|gb|EAR28846.1| Cell division protein [Pseudoalteromonas tunicata D2] Length=410 Score = 466 bits (1198), Expect = 1e-129, Method: Composition-based stats. Identities = 233/420 (55%), Positives = 304/420 (72%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K+ +R LV+GL++GT+KV A VGE+ D ++I+GVG+ S GMDKGGVNDL V + Sbjct 1 MTKSAERNLVIGLDVGTSKVVATVGEITADNKISIVGVGTQVSHGMDKGGVNDLNLVSES 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID AE+MADC+ISSVYL +SGKHI CQNE G+V I+ EV +D+ENV+H AKSV Sbjct 61 IQRAIDAAEIMADCRISSVYLGISGKHIQCQNENGVVAINNAEVGPDDIENVIHIAKSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E ++LH +PQEY+ID QEGIKNP+G+SGVRM+A+ H+ITC NDMAKNI K VERCGL Sbjct 121 ISAERKMLHALPQEYSIDMQEGIKNPLGMSGVRMEARAHIITCSNDMAKNIEKCVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF+ LAS YSVLTEDE+ELGV V+DIGGGTMDI +YT G+LRH+ VI AGN VT Sbjct 181 QVDQLIFSALASGYSVLTEDEKELGVAVIDIGGGTMDITIYTNGSLRHSAVITVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DIA F TP S AEAIKV++ CA ++++EVPSVGGRP R + R TLAEV+EPR Sbjct 241 GDIAKIFRTPISHAEAIKVQYACASSQRASTEDTIEVPSVGGRPARIMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 + EL L EEI R+ G++ +AAG+VLTGG A++ A+ +F R+G+ Sbjct 301 FRELFELAMEEI-------RRSGLEEQIAAGVVLTGGTAKMAYALEIAEEIFQMPARVGS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ + GL+DY +P ++TAVGLL YG+ + A K ++ +W R+ W + EF Sbjct 354 PIGMVGLSDYVNDPSFATAVGLLQYGRTMQV---ANARKSTESTSANWWNRVTKWFQGEF 410 >gi|88794391|ref|ZP_01110099.1| cell division protein FtsA [Alteromonas macleodii 'Deep ecotype'] gi|88774157|gb|EAR05414.1| cell division protein FtsA [Alteromonas macleodii 'Deep ecotype'] Length=452 Score = 465 bits (1197), Expect = 1e-129, Method: Composition-based stats. Identities = 226/373 (60%), Positives = 294/373 (78%), Gaps = 7/373 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT++V A+VGE+L D ++I+GVG+ S+GMDKGGVNDL VVK Sbjct 81 MSKPAERNLIVGLDIGTSQVKAVVGELLEDDQISIVGVGTHASKGMDKGGVNDLNLVVKS 140 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+++ ELMADC++SSV++++SG+H+ CQNE GMVPI+ +EVTQEDV+NV+H A+SV Sbjct 141 VQRAVNEMELMADCRVSSVFMSISGRHVKCQNENGMVPINNQEVTQEDVDNVIHAARSVP 200 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQE+ ID QEGIKNP+G+SGVRM+A H+ITC +DMAKN+VK VERC L Sbjct 201 IAAERRLLHVLPQEFTIDVQEGIKNPIGMSGVRMEADAHIITCADDMAKNMVKCVERCEL 260 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DERELGVCVVDIGGGTMD+ +YT GA+RHT VIP AGN +T Sbjct 261 NADQLIFSALASSYAVLTDDERELGVCVVDIGGGTMDMVIYTDGAIRHTAVIPVAGNQIT 320 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S+AE IKV + CAL +V ++S+EVPSVGGRP R + R TLAEVIEPR Sbjct 321 SDIAKIFRTPISNAEEIKVNYACALKDMVSMEDSIEVPSVGGRPARVMSRHTLAEVIEPR 380 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV++EI R G++ +AAG+VLTGG A++EG A+ +F VR+G Sbjct 381 YQELFELVHDEI-------RASGLEEQIAAGLVLTGGTAKMEGAVEFAEELFQMPVRVGK 433 Query 361 PLNITGLTDYAQE 373 P+N+ GL++Y + Sbjct 434 PINVKGLSEYVDD 446 >gi|68057890|gb|AAX88143.1| Gene info cell division protein FtsA [Haemophilus influenzae 86-028NP] gi|68249691|ref|YP_248803.1| Gene info cell division protein FtsA [Haemophilus influenzae 86-028NP] gi|46133310|ref|ZP_00156982.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus influenzae R2866] gi|46129003|ref|ZP_00155596.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus influenzae R2846] Length=425 Score = 455 bits (1170), Expect = 2e-126, Method: Composition-based stats. Identities = 225/425 (52%), Positives = 312/425 (73%), Gaps = 5/425 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K + K +VGLE+GT+KV A+VGEV PDG+VN++GVGSCPS+G+D+G + DL++VV Sbjct 1 MVKGVETKTIVGLEVGTSKVVAVVGEVFPDGVVNVLGVGSCPSKGIDRGSITDLDAVVGS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE MADCQI SV LA++G+HI NE G VPI+E EVTQE++++ +HTA S++ Sbjct 61 IQRAIEAAESMADCQIMSVTLAITGEHIQSLNESGFVPIAESEVTQEEIDSALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q IKNP+GL GVR++A+VHLI CH D N+ KAVERCGL Sbjct 121 LPEGLSLLHVIPQEYAVDRQMNIKNPLGLQGVRLKAQVHLIACHQDWQNNLKKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+++F+G A+++SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN+VT Sbjct 181 QVDKVVFSGFAATHSVLTEDEKDLGVCLIDFGAGTMNVMVYTNGALRFSKVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCAL-GSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA+A ++AE IKV + A + + D+ +EV S+GGR PRSL + L+ + Sbjct 241 NDIAHACTISRAEAERIKVNYASAFYPARLHGDKKIEVASIGGRAPRSLTKSDLSLITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RYTELL +V +E+ +L+ +L + +K L AG+V+TGG AQIE L CA VFH QVRI Sbjct 301 RYTELLGVVKDELDKLKAELEAKHIKFELIAGVVITGGGAQIEDLKECASNVFHCQVRIA 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESH----LNGEAEVEKRVTASVGSWIKRLNSW 415 +PLNITGLTDY P YST VGLL Y + ++G + E S+ +K++ + Sbjct 361 SPLNITGLTDYVNRPQYSTVVGLLQYNHSNSDDDLISGSDDSEGTFFESIWQGVKKIVNK 420 Query 416 LRKEF 420 +R EF Sbjct 421 VRSEF 425 >gi|1169751|sp|P45068|FTSA_HAEIN Cell division protein ftsA gi|1574698|gb|AAC22797.1| Gene info cell division protein (ftsA) [Haemophilus influenzae Rd KW20] gi|16273068|ref|NP_439300.1| Gene info cell division protein [Haemophilus influenzae Rd KW20] Length=425 Score = 449 bits (1156), Expect = 7e-125, Method: Composition-based stats. Identities = 224/425 (52%), Positives = 311/425 (73%), Gaps = 5/425 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K + K +VGLE+GT+KV +VGEV PDG+VN++GVGSCPS+G+D+G + DL++VV Sbjct 1 MVKGVETKTIVGLEVGTSKVVVVVGEVFPDGVVNVLGVGSCPSKGIDRGSITDLDAVVGS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE MADCQI SV LA++G+HI NE G VPI+E EVTQE++++ +HTA S++ Sbjct 61 IQRAIEAAESMADCQIMSVTLAITGEHIQSLNESGFVPIAESEVTQEEIDSALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q IKNP+GL GVR++A+VHLI CH D N+ KAVERCGL Sbjct 121 LPEGLSLLHVIPQEYAVDRQMNIKNPLGLQGVRLKAQVHLIACHQDWQNNLKKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+++F+G A+++SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN+VT Sbjct 181 QVDKVVFSGFAATHSVLTEDEKDLGVCLIDFGAGTMNVMVYTNGALRFSKVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCAL-GSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA+A ++AE IKV + A + + D+ +EV S+GGR PRSL + L+ + Sbjct 241 NDIAHACTISRAEAERIKVNYASAFYPARLHGDKKIEVASIGGRAPRSLTKSDLSLITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RYTELL +V +E+ +L+ +L + +K L AG+V+TGG AQIE L CA VFH QVRI Sbjct 301 RYTELLGVVKDELDKLKAELEAKHIKFELIAGVVITGGGAQIEDLKECASNVFHCQVRIA 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHY----GKESHLNGEAEVEKRVTASVGSWIKRLNSW 415 +PLNITGLTDY P YST VGLL Y + ++G + E S+ +K++ + Sbjct 361 SPLNITGLTDYVNRPQYSTVVGLLQYNYSNSDDDLISGSDDSEGTFFESIWQGVKKIVNK 420 Query 416 LRKEF 420 +R EF Sbjct 421 VRSEF 425 >gi|88704104|ref|ZP_01101819.1| Cell division protein FtsA [gamma proteobacterium KT 71] gi|88701931|gb|EAQ99035.1| Cell division protein FtsA [gamma proteobacterium KT 71] Length=410 Score = 433 bits (1113), Expect = 7e-120, Method: Composition-based stats. Identities = 224/422 (53%), Positives = 301/422 (71%), Gaps = 14/422 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A DR+++VGL+IGT+KV A+VGEVL DG + +IG+GS PS+GM KG V ++ES V+ Sbjct 1 MAAAKDRRMIVGLDIGTSKVVAIVGEVLADGSIEVIGIGSHPSKGMKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+D+AELMA CQI SVY+ ++G HI N G+V I E+EV +D+E V+ A++V Sbjct 61 IQRAVDEAELMAGCQIHSVYVGIAGSHIRSLNSHGIVAIKEQEVVGQDLERVIDAARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +VLHV+PQEY ID QEGIK P G+SGVR++AKVHL+TC + A+NI K + +CGL Sbjct 121 IPADQKVLHVLPQEYVIDSQEGIKEPQGMSGVRLEAKVHLVTCAVNAAQNIEKCIRKCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V+ +I LASSYSVLT+DERELGVC+VDIGGGT DIA++T G++RHT VIP AG+ VT Sbjct 181 EVEDIILEQLASSYSVLTDDERELGVCLVDIGGGTTDIAIFTEGSIRHTGVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G D++++VPSVG RPPR L RQ+LAEV+EPR Sbjct 241 NDIAMALRTPSQYAEEIKIRYACALTQLAGADQTIKVPSVGDRPPRDLSRQSLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + +GIVLTGG +++EG + A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGFEDLIPSGIVLTGGTSKMEGASELAEEIFHMPVRVGY 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKE--SHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 P +I GL D + P YSTAVGLL YG ++G A AS +W RL+ W R Sbjct 354 PQSIDGLADIVRNPIYSTAVGLLLYGSRHAGEVHGGAP-----RASGEAWWTRLSRWFRD 408 Query 419 EF 420 F Sbjct 409 SF 410 >gi|53729115|ref|ZP_00134079.2| COG0849: Actin-like ATPase involved in cell division [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length=424 Score = 431 bits (1108), Expect = 3e-119, Method: Composition-based stats. Identities = 218/419 (52%), Positives = 302/419 (72%), Gaps = 5/419 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGL+IGT+KV A+VGEVLPDG++N+IG GSCP++G+D+GGV DL++ V Sbjct 1 MTKIAESKIIVGLDIGTSKVVAVVGEVLPDGVINVIGSGSCPAKGVDRGGVIDLDAAVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+QAE ++DCQI V LA+SG+HI+ NE G VP+S VT ED++ +H A+S++ Sbjct 61 IQRAIEQAESVSDCQIIGVTLAISGQHITALNESGTVPLSGT-VTNEDIDAAIHIARSIK 119 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D LH+IPQEY +D KNPVGLSG+R+QA+ H++ CH D +N+ AVER L Sbjct 120 LPDGLETLHIIPQEYKVDRLPATKNPVGLSGMRLQAQAHIVACHQDWLRNLKNAVERAKL 179 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ++F+GLASSYSVLTEDE+ELGVC++DIGGGTMDI VYT GALR +KVIP+AGN VT Sbjct 180 KVDQVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTDGALRFSKVIPFAGNNVT 239 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 IA F T ++AE+IK+ +G A+ D+ +EV +GGR PR+ + +A V Sbjct 240 DYIAQVFTTSRNEAESIKINYGSAVNPPTHNADKKIEVAGLGGRMPRTFTKAQVATVTSQ 299 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 Y++LL +V E++QL+ +L Q+G+K L AG VLTGG +QIE + CA+ +F +QVR+G Sbjct 300 CYSDLLKVVENELVQLRHELLQKGIKQELIAGFVLTGGGSQIEDIVECAREIFGSQVRVG 359 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 PLNITGLTDY +P Y+T +GLL Y SH N + + ++ V S + L+ L+K Sbjct 360 YPLNITGLTDYVNKPQYATVLGLLQY---SHYNSDEKGNGEISEKVDSILDILSRGLKK 415 >gi|46156643|ref|ZP_00132283.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus somnus 2336] Length=424 Score = 422 bits (1084), Expect = 2e-116, Method: Composition-based stats. Identities = 220/386 (56%), Positives = 289/386 (74%), Gaps = 1/386 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + + K+ VGLE+GT+KV A+VGE+LPDG+VN++G GSCPS+G+DKG + DL +VV Sbjct 1 MARIVEDKIFVGLEVGTSKVVAVVGELLPDGVVNVLGAGSCPSKGIDKGSITDLNAVVTS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID E +AD QI SV LA++G+HI NE G VPI+EEEVTQE+VE +HTA SVR Sbjct 61 IQRAIDSTEAVADSQIFSVTLAITGEHIQSLNENGFVPIAEEEVTQEEVEAALHTASSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D +LH+IPQE+A+D Q IK+P+GL GVR+ A+ HLI CH D N+ KAVERC L Sbjct 121 IGDGLALLHIIPQEFAVDKQVNIKDPLGLQGVRLSAQAHLIACHQDWLNNLKKAVERCKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV++++++G ASS +VLTEDE+ELGVC++D G GTMDI VYT G +R +KVIPYAGN VT Sbjct 181 KVNKVVYSGYASSQAVLTEDEKELGVCLIDFGAGTMDIVVYTNGFIRFSKVIPYAGNRVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGK-DESVEVPSVGGRPPRSLQRQTLAEVIEP 299 DIAYA T ++AE+IKV +G A+ + D+ +EV S+GGR PR + ++ L+ + Sbjct 241 DDIAYACATSRTEAESIKVAYGSAVSPPLDPLDKKIEVASIGGRAPRVISKEQLSIITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY ELL +V E+ QL+ +L + +K L AGIV+TGG AQIEGL CA +VF +QVRIG Sbjct 301 RYAELLGVVKSELDQLKYQLENKQIKFELIAGIVITGGGAQIEGLRECATQVFGSQVRIG 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHY 385 PLNITGLTDY +P YST VGLLH+ Sbjct 361 VPLNITGLTDYVNKPQYSTVVGLLHH 386 >gi|33148197|gb|AAP95717.1| Gene info cell division protein FtsA [Haemophilus ducreyi 35000HP] gi|33151975|ref|NP_873328.1| Gene info cell division protein FtsA [Haemophilus ducreyi 35000HP] Length=426 Score = 418 bits (1075), Expect = 2e-115, Method: Composition-based stats. Identities = 210/429 (48%), Positives = 303/429 (70%), Gaps = 12/429 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGL+IGT+K+A +VGEVLPDG++N++G +CPS+G+D+GGV DL++ V Sbjct 1 MTKIAESKIIVGLDIGTSKIAVVVGEVLPDGVINVLGASNCPSKGIDRGGVIDLDAAVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+QAE +++CQI V LA+SG+HI+ NE G++P+S V +ED++ +H A S++ Sbjct 61 IQRAIEQAESVSNCQIMGVTLAISGQHITALNESGVIPLSGTVVRKEDIDAAIHIAHSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D LH+I QEY +D KNP+GLSG+R++A+ H+I CH D +N+ A ER L Sbjct 121 LPDGLENLHIIAQEYNVDQLPATKNPIGLSGMRLRAQAHIIACHQDWLRNLKNAAERAKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD ++F+GLASSYSVLTEDE+ELGVC++DIGGGTMDI VYT ALR +KVIPYAGN VT Sbjct 181 KVDTVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTDNALRFSKVIPYAGNNVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALG-SIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 IA F T S+AEAIK ++G A+ D+ +E+ +GGR PR+ + +A V Sbjct 241 DYIANVFTTSRSEAEAIKTKYGNAVSLPNHSPDQKIEIAGLGGRMPRTFTKADVATVTSK 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 Y +LL LV E+ +L+++L Q+G+K L AG VLTGG +QIE + CA+ +F +QVR+G Sbjct 301 CYNDLLTLVQVELTKLRDELFQKGIKQELIAGFVLTGGGSQIEDIVECAKNIFGSQVRVG 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGE-----AEVEKRVTA---SVGSWIKR 411 +PLNI+GLTDY +P Y+TA+GLL Y SH N + EV ++V + + + +K+ Sbjct 361 SPLNISGLTDYVNKPLYATALGLLQY---SHYNSQKESNNGEVGEKVDSLLDILSNSVKK 417 Query 412 LNSWLRKEF 420 + +W + F Sbjct 418 VVNWAKSSF 426 >gi|52307769|gb|AAU38269.1| Gene info FtsA protein [Mannheimia succiniciproducens MBEL55E] gi|52425717|ref|YP_088854.1| Gene info FtsA protein [Mannheimia succiniciproducens MBEL55E] Length=430 Score = 418 bits (1075), Expect = 2e-115, Method: Composition-based stats. Identities = 210/430 (48%), Positives = 299/430 (69%), Gaps = 10/430 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K +VGLE+GT+KV A+VGEVLPDG+VN++GVGSCPS+G+DKG + DL +VV Sbjct 1 MAKIVESKTIVGLEVGTSKVVAVVGEVLPDGVVNVLGVGSCPSKGIDKGSITDLAAVVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE +ADCQI SV LA++G+HI NE G VPI++ EVTQ++++ +HTA SV+ Sbjct 61 IQRAIEAAESVADCQIMSVTLAITGEHIQSLNESGFVPIADGEVTQDEIDQAMHTASSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q+ IKNP+GL GVR++A+ HLI H N+ KAVE CGL Sbjct 121 LPEGLSLLHVIPQEYAVDKQQNIKNPLGLQGVRLKAQAHLIAGHQAWVNNLQKAVETCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ++F+GLAS+YSVLTEDE++LGVC++D GGG+MDI VYT GALR++KV+PY GN +T Sbjct 181 KVDQVVFSGLASTYSVLTEDEKDLGVCLIDFGGGSMDIMVYTNGALRYSKVVPYGGNTIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVG-----KDESVEVPSVGGRPPRSLQRQTLAE 295 +A + T ++AE+IK+ +G A + +EV +GG PR+ + + E Sbjct 241 DFVAQSLTTSRNEAESIKINYGSAFMPSAELLEQFAKKKIEVAGLGGGAPRTFTKAQVVE 300 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 V Y +LL +V E+ QL+ +L +G+K L AG VLTGG++Q+ +A CA +F + Sbjct 301 VTSRCYHDLLQVVENELTQLRNELAMRGIKQELIAGFVLTGGSSQMTDIAKCATDIFESH 360 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYG-----KESHLNGEAEVEKRVTASVGSWIK 410 VR+G PLNITGLTDY +P Y+T +GLL Y + + + G + E S+ K Sbjct 361 VRVGYPLNITGLTDYVNKPQYATVLGLLQYSHHNEEESTQMFGGSASESSFLGSIFEKCK 420 Query 411 RLNSWLRKEF 420 ++ + ++ EF Sbjct 421 KIANKVKSEF 430 >gi|75429980|ref|ZP_00732550.1| ATPases of the HSP70 class involved in cell division [Actinobacillus succinogenes 130Z] gi|74276763|gb|EAO50355.1| ATPases of the HSP70 class involved in cell division [Actinobacillus succinogenes 130Z] Length=430 Score = 417 bits (1071), Expect = 6e-115, Method: Composition-based stats. Identities = 213/430 (49%), Positives = 297/430 (69%), Gaps = 10/430 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K +VGLE+GT KV A+VGEVLPDG+VN++GVGS PS+G+DKG + DL +VV Sbjct 1 MAKIVESKTIVGLEVGTTKVVAVVGEVLPDGVVNVLGVGSSPSKGIDKGSITDLSAVVSS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE +ADCQI SV LA++G+HI NE G VPI+ EVTQ+++++ +HTA SV+ Sbjct 61 IQRAIENAESVADCQIVSVTLAITGEHIQSFNESGFVPIANGEVTQDEIDSAMHTASSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D +LHVIPQE+A+D Q IK+P+GL GVR++A+ HLI C N+ KAVE CGL Sbjct 121 LPDGLSLLHVIPQEFAVDKQHNIKSPLGLQGVRLKAQAHLIGCQQAWLTNLQKAVESCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD ++F+GLAS+YSVLTEDE++LGVC++D GGG+MDI VYT GALR++KV+PY GN +T Sbjct 181 KVDDVVFSGLASTYSVLTEDEKDLGVCMIDFGGGSMDIMVYTNGALRYSKVVPYGGNDIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDE-----SVEVPSVGGRPPRSLQRQTLAE 295 +A + T ++AE+IK+ +G AL E VEV +GG R+ + + + Sbjct 241 DFVAQSLTTSRNEAESIKINYGSALNPSQELVEHFAKTKVEVAGLGGTSSRTFTKAQIVD 300 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 V Y +LL +V E++ L+ L +G+KH L AG+VLTGG AQ+E +A CA +F Sbjct 301 VTSKCYGDLLKVVQNELINLRNDLTVKGIKHDLIAGVVLTGGGAQMEDVAKCATDIFGLH 360 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESH-----LNGEAEVEKRVTASVGSWIK 410 VR+G+PLNITGLTDY +P Y+T +GLL Y + + G E + S+ S IK Sbjct 361 VRVGSPLNITGLTDYVNKPQYATVLGLLQYTHHNDEETKPIFGSVNDEDSILGSIWSKIK 420 Query 411 RLNSWLRKEF 420 ++ + +R EF Sbjct 421 KIGNKVRSEF 430 >gi|88811833|ref|ZP_01127086.1| Cell division protein FtsA [Nitrococcus mobilis Nb-231] gi|88790717|gb|EAR21831.1| Cell division protein FtsA [Nitrococcus mobilis Nb-231] Length=412 Score = 412 bits (1060), Expect = 1e-113, Method: Composition-based stats. Identities = 215/417 (51%), Positives = 294/417 (70%), Gaps = 8/417 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT+KVAA+VGE P G V ++G+GS PSRG+ KG V ++ES V+ Sbjct 1 MTKKQERSLLVGLDIGTSKVAAIVGETKPAGEVEVVGIGSHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA CQI SVY +SG H+ N G+V I ++EVT DVE V+ A++V Sbjct 61 IQRAVEEAELMAGCQIHSVYAGISGSHVRSLNSHGIVAIRDKEVTAGDVERVIDAARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +++H++PQE+ ID QEGI+ P+G+SGVR++AKVH++T A+NI+K V RCGL Sbjct 121 IPADQKIIHILPQEFLIDSQEGIREPIGMSGVRLEAKVHMVTGAVSAAQNIIKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 + D +I LASS SVLT+DE+ELGVC+VDIGGGT D+AV+T GA+RHT VIP AG+ VT Sbjct 181 EADDIILQQLASSQSVLTDDEKELGVCLVDIGGGTTDVAVFTDGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKVR+ CAL + +E++EVPSV RPPR L RQTLAEV+EPR Sbjct 241 NDIAVALRTPTQYAEEIKVRYACALSQLASAEETIEVPSVADRPPRRLSRQTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL++LV Q +LR+ G + +AAGIVLTGG+A++EG+ A+ VFH VR+G Sbjct 301 YEELMSLV-------QAELRRSGFEDLIAAGIVLTGGSAKMEGVIDLAEEVFHMPVRLGM 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLR 417 P + TGL+D P Y+T +GLL +G S + E+ G W +R+ W + Sbjct 354 PKHATGLSDVVCNPVYATGLGLLLFGSNSRGSHRMELNAADGGIAGLW-QRMKGWFQ 409 >gi|78701777|ref|ZP_00866224.1| Cell division protein FtsA [Alkalilimnicola ehrlichei MLHE-1] gi|78520659|gb|EAP33919.1| Cell division protein FtsA [Alkalilimnicola ehrlichei MLHE-1] Length=412 Score = 410 bits (1053), Expect = 7e-113, Method: Composition-based stats. Identities = 214/420 (50%), Positives = 294/420 (70%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K ++R L+VGL+IGT+KV A+VGE DG + ++G+GS PS G+ KG V ++ES V+ Sbjct 1 MVKKSERNLLVGLDIGTSKVVAIVGEAGEDGEIEVVGIGSHPSSGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+++AELMA C+I S Y+ +SG HI N GMV I + EVTQ D++ V+ A++V Sbjct 61 VQRAVEEAELMAGCEIHSAYVGISGSHIKSMNSHGMVAIKDREVTQGDLDRVLDGARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + R+LHV+PQE+ ID QEGI++P+G+SGVR++A+VH++T A+NI K V RCGL Sbjct 121 IPADQRILHVLPQEFVIDNQEGIRHPLGMSGVRLEARVHMVTGAVSAAENITKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD ++ LAS+ +VLT+DERELGVC+VDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 EVDDVVLQQLASAQAVLTDDERELGVCLVDIGGGTTDIAVFTGGAIRHTAVIPIAGHQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKV++ CAL + +ES+EVPSVG RPPR L RQ+LA V+EPR Sbjct 241 NDIAVALRTPTQHAEEIKVKYACALSQLANPEESIEVPSVGDRPPRRLSRQSLAAVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV Q +LR+ G + + AG+VLTGG++++EG+ A+ VFH VR + Sbjct 301 YEELLGLV-------QAELRRSGFEDLIPAGVVLTGGSSKMEGVVDLAEEVFHLPVRAAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +TGL+D + P YST VGLL YG H A + + + R+ SW + F Sbjct 354 PTQVTGLSDVVRNPIYSTGVGLLVYGAR-HEGKPALTDFSEEGGLQALWARMKSWFKGNF 412 >gi|88949782|ref|ZP_01152397.1| Cell division protein FtsA [Halorhodospira halophila SL1] gi|88926962|gb|EAR45927.1| Cell division protein FtsA [Halorhodospira halophila SL1] Length=412 Score = 408 bits (1048), Expect = 2e-112, Method: Composition-based stats. Identities = 212/420 (50%), Positives = 293/420 (69%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M++ ++ L+VGL+IGT+KV A+VGE DG + +IGVGS PS G+ KG V +++S V+ Sbjct 1 MVRKSEDSLLVGLDIGTSKVVAIVGEAKEDGELEVIGVGSHPSHGLKKGVVVNIDSTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C+I S Y+ +SG HI N GMV I ++EV Q D+E V+ AK+V Sbjct 61 IQRAIEEAELMAGCEIHSAYVGISGSHIRSLNSHGMVAIRDKEVRQADLERVLDGAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LHVIPQE+ ID QEGI++P+G++GVR++A+VH++T A NI K V RC L Sbjct 121 IPADQQILHVIPQEFVIDSQEGIRDPLGMAGVRLEARVHMVTGAVSAADNITKCVRRCQL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 VD ++ LA+S++VL++DE+ELGVC+VDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 DVDDIVLQQLAASHAVLSDDEKELGVCLVDIGGGTTDIAVFTGGAIRHTAVIPIAGHQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKVR+ CAL + +ES+EVPSVG RPPR L RQ+LA V+EPR Sbjct 241 NDIAVALRTPTHHAEDIKVRYACALSQLANPEESIEVPSVGDRPPRRLSRQSLASVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV Q +LR+ G + + AGIVLTGG++++EG+ A+ VFH VRIG Sbjct 301 YEELLALV-------QSELRKSGFEDLIPAGIVLTGGSSKMEGVTDLAEEVFHLPVRIGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +TGL+D + P YST VGLL +G + +G + + W R+ +W + F Sbjct 354 PKFVTGLSDVVRNPMYSTGVGLLAFGARNRDSGMSPALAQDAGMSALW-GRMKNWFKGNF 412 >gi|83648518|ref|YP_436953.1| Gene info cell division protein FtsA [Hahella chejuensis KCTC 2396] gi|83636561|gb|ABC32528.1| Gene info cell division protein FtsA [Hahella chejuensis KCTC 2396] Length=410 Score = 406 bits (1044), Expect = 7e-112, Method: Composition-based stats. Identities = 207/419 (49%), Positives = 293/419 (69%), Gaps = 9/419 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + ++ ++VGL+IGT+KV A+VG+ +G + ++G+GS PSRG+ +G V ++E+ V+ + Sbjct 1 MASSSGNMIVGLDIGTSKVVAIVGQRNQEGAIEVVGIGSHPSRGLKRGVVVNIETTVQAI 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 QRA+++AELMA C+I SVY ++G HI N G+V + + EV Q D+E V+ A++V + Sbjct 61 QRAVEEAELMAGCRIHSVYAGIAGSHIRSMNSHGIVAVRDREVVQADLERVLDAAQAVAI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + RVLHV+PQEY ID QEG+K PVG+SGVR++AKVHL+TC + +NI K V+RCGL+ Sbjct 121 PADQRVLHVVPQEYVIDNQEGVKEPVGMSGVRLEAKVHLVTCAVNAYQNIEKCVKRCGLE 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 VD++I LASSY+VLT+DE+ELGVCVVDIGGGT DIA++TGG++RHT VIP AG+ VT+ Sbjct 181 VDEIILEQLASSYAVLTDDEKELGVCVVDIGGGTTDIAIFTGGSIRHTAVIPIAGDQVTN 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA A TP +AE IK+++ CAL + G DE+++VP VG RP R L RQ+LAEV+EPRY Sbjct 241 DIAMALRTPTQNAEEIKIKYACALTQLAGADETIKVPGVGDRPSRDLSRQSLAEVVEPRY 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 EL L+ Q +LR+ G + +AAG+VLTGG + +EG+ A+ +FH VR+ P Sbjct 301 EELFTLI-------QSELRRSGYEDLIAAGVVLTGGTSSMEGVVELAEEIFHMPVRLAVP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +TGL+D P YSTAVGLL YG + G + A + +RL +W F Sbjct 354 QWVTGLSDVVSNPMYSTAVGLLLYGFKQQELGRGAQHRGEPAE--NLFQRLKNWFMGNF 410 >gi|12720363|gb|AAK02230.1| Gene info FtsA [Pasteurella multocida subsp. multocida str. Pm70] gi|15602011|ref|NP_245083.1| Gene info FtsA [Pasteurella multocida subsp. multocida str. Pm70] Length=426 Score = 405 bits (1042), Expect = 1e-111, Method: Composition-based stats. Identities = 214/426 (50%), Positives = 292/426 (68%), Gaps = 6/426 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGLE+GT+KV ALVGE+LPDG+VNI+GVGSCP++G+DKG + DL +VV Sbjct 1 MAKIVESKIIVGLEVGTSKVVALVGELLPDGVVNILGVGSCPAKGIDKGNITDLNAVVTS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAI+ AE +ADC+I SV LA++G+HI N+ G PI++ EVTQED++ +HTA S++ Sbjct 61 VQRAIELAESVADCEIISVTLAITGQHIQSWNDSGAAPIADTEVTQEDIDAALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + VLH +PQEYA+D Q+ IKNP+G G R+ + VHLI CH D N+ +AVERC L Sbjct 121 MPEGLVVLHRLPQEYAVDQQKNIKNPLGFQGGRLTSNVHLIACHQDWLNNLRQAVERCKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 K+D++IF+G+A+S+SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN VT Sbjct 181 KIDKVIFSGIATSHSVLTEDEKDLGVCLIDFGAGTMEVMVYTNGALRFSKVIPYAGNRVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSI-VGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 DIAY T +AE IKV++G A+ +E +V S+ G + L+ V Sbjct 241 DDIAYDLTTSRVEAENIKVKYGSAVTPPRQNPEEQFDVMSIDGSVIERCSKTRLSNVTAG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+L LV EE++QL+ L + +K L AGIV+TGG AQI+ L CA VF VRIG Sbjct 301 RYREILELVKEELIQLKYDLESKQMKFELIAGIVITGGGAQIKDLKECATDVFGLHVRIG 360 Query 360 APLNITGLTDYAQ-EPYYSTAVGLLHY----GKESHLNGEAEVEKRVTASVGSWIKRLNS 414 PLNITG+T + +P YST +GLL Y ES +N E S+ S +K++ Sbjct 361 NPLNITGVTHLVEKKPQYSTVLGLLQYEYSSNDESPINDAYSNESGFFGSLWSGMKKIAK 420 Query 415 WLRKEF 420 + EF Sbjct 421 KVGSEF 426 >gi|48861175|ref|ZP_00315079.1| COG0849: Actin-like ATPase involved in cell division [Microbulbifer degradans 2-40] Length=409 Score = 405 bits (1042), Expect = 1e-111, Method: Composition-based stats. Identities = 212/420 (50%), Positives = 291/420 (69%), Gaps = 11/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV A+VGE+ +G ++I+G+GS S G+ KG V ++ES V+ Sbjct 1 MANANGGKMIVGLDIGTSKVVAIVGEISAEGELSIVGIGSHKSVGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C I SVY ++G HI N G+V I + EV +D++ V+ A++V Sbjct 61 IQRAIEEAELMAGCSIHSVYAGIAGNHIRSLNSHGIVAIKDREVFAQDLDRVIDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + R+LH++PQEY ID QEG+K P+G+SGVR++AKVHL+TC + ++NI K + RCGL Sbjct 121 IPADQRILHILPQEYLIDEQEGVKEPLGMSGVRLEAKVHLVTCAVNASQNIEKCIRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V+ +I LASSY+VLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVEDIILEQLASSYAVLTDDEKELGVCMVDIGGGTTDIAIFTEGAIRHTGVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+++ CAL + G +E+++VPSVG RP R L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIKYACALAKLTGAEETIKVPSVGDRPARDLSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV Q +LR+ G + +AAGIVLTGG +++EG+ A+ +FH VR+GA Sbjct 301 YDELFTLV-------QAELRRSGFEDMVAAGIVLTGGTSKMEGVVDLAEEIFHMPVRLGA 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P + GL D P YST VGLL YG E A T S S + RL SW ++ F Sbjct 354 PQGVKGLKDIVTNPIYSTGVGLLLYGAEQQKGERAH----STPSGESAVSRLKSWFQRNF 409 >gi|77384893|gb|ABA76406.1| Gene info Cell division protein FtsA [Pseudomonas fluorescens PfO-1] gi|77460890|ref|YP_350397.1| Gene info Cell division protein FtsA [Pseudomonas fluorescens PfO-1] Length=419 Score = 404 bits (1038), Expect = 4e-111, Method: Composition-based stats. Identities = 203/393 (51%), Positives = 279/393 (70%), Gaps = 7/393 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVADDGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSAADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTSKMEGATELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG 393 P + GL D + P YST VGLL YG + +G Sbjct 354 PHGVKGLDDVVRNPIYSTGVGLLMYGLQKQSDG 386 >gi|66047325|ref|YP_237166.1| Gene info Cell division protein FtsA [Pseudomonas syringae pv. syringae B728a] gi|63258032|gb|AAY39128.1| Gene info Cell division protein FtsA [Pseudomonas syringae pv. syringae B728a] Length=418 Score = 403 bits (1036), Expect = 6e-111, Method: Composition-based stats. Identities = 205/393 (52%), Positives = 280/393 (71%), Gaps = 7/393 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG 393 P ++ GL D + P YST VGLL YG + +G Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLMYGLQKQSDG 386 >gi|71557836|gb|AAZ37047.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. phaseolicola 1448A] gi|71737283|ref|YP_276226.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. phaseolicola 1448A] Length=418 Score = 403 bits (1036), Expect = 6e-111, Method: Composition-based stats. Identities = 205/393 (52%), Positives = 280/393 (71%), Gaps = 7/393 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG 393 P ++ GL D + P YST VGLL YG + +G Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLMYGLQKQSDG 386 >gi|26988075|ref|NP_743500.1| Gene info cell division protein FtsA [Pseudomonas putida KT2440] gi|24982799|gb|AAN66964.1| Gene info cell division protein FtsA [Pseudomonas putida KT2440] Length=443 Score = 403 bits (1036), Expect = 7e-111, Method: Composition-based stats. Identities = 203/386 (52%), Positives = 279/386 (72%), Gaps = 7/386 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 24 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 83 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 84 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 143 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 144 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 203 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 204 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 263 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 264 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 323 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 324 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 376 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYG 386 P ++ GL+D + P YST VGLL YG Sbjct 377 PHSVRGLSDVVRNPIYSTGVGLLTYG 402 >gi|67677010|ref|ZP_00473752.1| Cell division protein FtsA [Chromohalobacter salexigens DSM 3043] gi|67518882|gb|EAM22842.1| Cell division protein FtsA [Chromohalobacter salexigens DSM 3043] Length=423 Score = 402 bits (1034), Expect = 9e-111, Method: Composition-based stats. Identities = 209/378 (55%), Positives = 273/378 (72%), Gaps = 7/378 (1%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT+KV A+VG+ DG + I G+GS PSRGM KG V ++ES V+ +QRA+++A Sbjct 10 MVVGLDIGTSKVVAIVGQPSDDGSIEIAGIGSHPSRGMKKGVVINIESTVQSIQRAVEEA 69 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C I SVY+ ++G HIS N G+V I E EVT D++ V+ +A++ + + R+L Sbjct 70 ELMAGCDIHSVYVGVAGSHISSMNSDGVVAIKEREVTPSDIDRVIDSARARAISEGQRIL 129 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQE+AID QEGI+ P+G+SGVR++A+VHL+T + +NI K V RCGL+VD +I Sbjct 130 HVLPQEFAIDNQEGIREPLGMSGVRLEARVHLVTAALNAVQNIEKCVRRCGLEVDDIILE 189 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASSY+VLTEDERELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ VT+DIA A Sbjct 190 QLASSYAVLTEDERELGVCMVDIGGGTTDIAVFTEGAIRHTAVIPIAGDQVTNDIAMALR 249 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IKV++ CAL + DE ++VPSVG RP R L RQ LAEV+EPRY EL LV Sbjct 250 TPTQYAEDIKVKYACALTQLASSDEMIKVPSVGDRPARDLSRQALAEVVEPRYEELFTLV 309 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 EE LR+ G + +AAG+VLTGG +++EG+ A+ +FH VRI P N+ GL Sbjct 310 REE-------LRRSGYEDLVAAGVVLTGGTSRMEGVVELAEEIFHMPVRIAYPHNVRGLA 362 Query 369 DYAQEPYYSTAVGLLHYG 386 D + P YST VGLL YG Sbjct 363 DVVRNPIYSTGVGLLLYG 380 >gi|82738698|ref|ZP_00901525.1| Cell division protein FtsA [Pseudomonas putida F1] gi|82714264|gb|EAP49351.1| Cell division protein FtsA [Pseudomonas putida F1] Length=420 Score = 402 bits (1034), Expect = 1e-110, Method: Composition-based stats. Identities = 203/386 (52%), Positives = 279/386 (72%), Gaps = 7/386 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYG 386 P ++ GL+D + P YST VGLL YG Sbjct 354 PHSVRGLSDVVRNPIYSTGVGLLTYG 379 >gi|28871539|ref|NP_794158.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. tomato str. DC3000] gi|28854790|gb|AAO57853.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. tomato str. DC3000] Length=418 Score = 402 bits (1034), Expect = 1e-110, Method: Composition-based stats. Identities = 205/393 (52%), Positives = 280/393 (71%), Gaps = 7/393 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSAADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG 393 P ++ GL D + P YST VGLL YG + +G Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLLYGLQKQSDG 386 >gi|68346679|gb|AAY94285.1| Gene info cell division protein FtsA [Pseudomonas fluorescens Pf-5] gi|70732380|ref|YP_262136.1| Gene info cell division protein FtsA [Pseudomonas fluorescens Pf-5] Length=419 Score = 402 bits (1034), Expect = 1e-110, Method: Composition-based stats. Identities = 207/426 (48%), Positives = 295/426 (69%), Gaps = 13/426 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT D+A++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDMAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTSKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG--EAEVEKRVTASV----GSWIKRLNS 414 P ++ GL+D + P YST VGLL YG + +G + + R + S + + R+ S Sbjct 354 PHSVKGLSDVVRNPIYSTGVGLLLYGLQKQSDGISFSGIGSRDSYSSDEPKAALLDRIKS 413 Query 415 WLRKEF 420 W++ F Sbjct 414 WVQGNF 419 >gi|2707899|gb|AAB92376.1| FtsA [Pseudomonas putida] Length=420 Score = 402 bits (1033), Expect = 2e-110, Method: Composition-based stats. Identities = 203/386 (52%), Positives = 279/386 (72%), Gaps = 7/386 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYTCALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYG 386 P ++ GL+D + P YST VGLL YG Sbjct 354 PHSVRGLSDVVRNPIYSTGVGLLTYG 379 >gi|77955512|ref|ZP_00819874.1| Cell division protein FtsA [Marinobacter aquaeolei VT8] gi|77865583|gb|EAO96904.1| Cell division protein FtsA [Marinobacter aquaeolei VT8] Length=411 Score = 402 bits (1032), Expect = 2e-110, Method: Composition-based stats. Identities = 206/420 (49%), Positives = 293/420 (69%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M ++VGL+IGT+KV A+VG+ DG + ++G+GS PSRG+ +G V ++E+ V+ Sbjct 1 MSSVETENMIVGLDIGTSKVVAIVGKRKMDGTIEVVGIGSHPSRGLKRGVVVNIETTVQA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++G HI N G+V I + EVTQ D++ V+ A++V Sbjct 61 IQRAVEEAELMAGCRIHSVYAGIAGSHIKSLNSHGIVAIRDREVTQADIDRVIDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEGIK P+G+SGVR++AKVHL+TC + A+NI K V+RCGL Sbjct 121 IPADQKILHILPQEFVIDNQEGIKEPMGMSGVRLEAKVHLVTCAVNAAQNIEKCVKRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LASS+++LTEDE+ELGVCVVDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASSHAILTEDEKELGVCVVDIGGGTTDIAVFTGGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP +AE IK+++ CAL + G +E+++VPSVG R PR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQNAEEIKIKYACALTQLAGAEETIKVPSVGDRAPRDLSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV Q +LR+ G + + AGIV+TGG++ +EG+ A+ +FH VR+ Sbjct 301 YEELFTLV-------QSELRRSGFEDLIPAGIVITGGSSTMEGVVELAEEIFHMPVRLAC 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++G+T+ P Y+T VGLL +G G A V K A S ++R+ +W F Sbjct 354 PQAVSGMTEVVNNPIYATGVGLLIHGFRQMDLGRAPVLKGEEAP--SLVERMKAWFTGHF 411 >gi|9950640|gb|AAG07796.1| Gene info cell division protein FtsA [Pseudomonas aeruginosa PAO1] gi|15599604|ref|NP_253098.1| Gene info cell division protein FtsA [Pseudomonas aeruginosa PAO1] gi|46164864|ref|ZP_00137896.2| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa UCBPP-PA14] gi|6715614|gb|AAA95992.2| FtsA [Pseudomonas aeruginosa] gi|12644662|sp|P47203|FTSA_PSEAE Cell division protein ftsA gi|84323060|ref|ZP_00971137.1| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa 2192] gi|84317039|ref|ZP_00965496.1| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa C3719] Length=417 Score = 401 bits (1030), Expect = 3e-110, Method: Composition-based stats. Identities = 203/386 (52%), Positives = 275/386 (71%), Gaps = 7/386 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + ++G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MASVQSGKMIVGLDIGTSKVVALVGEVTADGQLEVVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID+A+ MA C+I S ++ ++G HI N G+V I + EV D+E V+ A++V Sbjct 61 IQRAIDEAQQMAGCRIHSAFVGIAGNHIRSLNSHGIVAIRDREVNPADIERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH + Q+Y ID QEG++ P+G+SGVR++AKVH++TC + ++NI K V RCGL Sbjct 121 IPADQRVLHTLAQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNASQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLTEDE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTEDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLV-------QAELRRSGYEDLIPAGIVLTGGTSKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYG 386 P ++ GLTD + P YST VGLL YG Sbjct 354 PYSVKGLTDVVRNPIYSTGVGLLMYG 379 >gi|53757202|gb|AAU91493.1| Gene info cell division protein FtsA [Methylococcus capsulatus str. Bath] gi|53803441|ref|YP_114838.1| Gene info cell division protein FtsA [Methylococcus capsulatus str. Bath] Length=411 Score = 400 bits (1029), Expect = 5e-110, Method: Composition-based stats. Identities = 198/394 (50%), Positives = 288/394 (73%), Gaps = 7/394 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +D+ ++VGL+IGT+KVA LVGEV DG + ++G+G+ PSRG+ KG V +LE+ V Sbjct 1 MGKKSDKNVIVGLDIGTSKVACLVGEVNEDGQIEVVGLGTHPSRGLKKGVVVNLETTVHS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA +I SVY ++G HIS N G+V I ++EVTQ DV+ V+ +A++V Sbjct 61 IQRAVEEAELMAGFRIHSVYAGIAGSHISSMNSHGIVAIRDKEVTQGDVDRVIDSARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEG+K P+G+SG+R++A+VH++T A+NI K ++RCGL Sbjct 121 IPADQKILHILPQEFVIDRQEGVKEPIGMSGIRLEARVHIVTGAVSAAQNIQKCIQRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD ++ LASS +VLT+DE+ELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ VT Sbjct 181 EVDDIVLEQLASSQAVLTDDEKELGVCLVDIGGGTTDIAVFTDGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEA+K++H CAL + ++++EVPS+G RP R + R LAE++EPR Sbjct 241 NDIAVALRTPTPHAEALKLKHACALTQLADIEDTIEVPSIGDRPSRQISRLNLAEIVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV Q +LR+ G +AAGIVL+GG++++EGL A+ +FH VR+G Sbjct 301 YEELLLLV-------QAELRRAGFDDLIAAGIVLSGGSSRVEGLVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGE 394 P ++GL D + P Y+T VGLL +G++ +GE Sbjct 354 PYTVSGLNDVIRNPAYATGVGLLLHGRQHLFSGE 387 >gi|67156140|ref|ZP_00417766.1| Cell division protein FtsA [Azotobacter vinelandii AvOP] gi|67086470|gb|EAM05939.1| Cell division protein FtsA [Azotobacter vinelandii AvOP] Length=415 Score = 399 bits (1025), Expect = 1e-109, Method: Composition-based stats. Identities = 211/425 (49%), Positives = 289/425 (68%), Gaps = 15/425 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+GS PSRG+ KG V ++ES V+ Sbjct 1 MASAQSGKMIVGLDIGTSKVVALVGEVTADGQLEIVGIGSHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA CQI S ++ L+G HI N G+V I + EV+Q D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCQIHSAFVGLAGNHIRSLNSHGIVAIRDREVSQADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+N+ K V RC L Sbjct 121 IPSDQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNVEKCVRRCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+++VLTEDERELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAHAVLTEDERELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E++ VPSVG RP R L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLTGAGETINVPSVGERPSRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +L++ E L++ G + + AG+VLTGG+A++EG A+ +FH VR+G Sbjct 301 YDELFSLIHAE-------LQRSGYEDLIPAGVVLTGGSAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIK-----RLNSW 415 P ++ G+ D P YST VGLL YG + G T+S G K RL W Sbjct 354 PHSVRGMDDVIGNPIYSTGVGLLLYGLQKQTEG---TPVSGTSSYGEETKIPVLERLKRW 410 Query 416 LRKEF 420 + F Sbjct 411 FQGNF 415 >gi|76884621|gb|ABA59302.1| Gene info Cell division protein FtsA [Nitrosococcus oceani ATCC 19707] gi|77166307|ref|YP_344832.1| Gene info Cell division protein FtsA [Nitrosococcus oceani ATCC 19707] Length=411 Score = 399 bits (1025), Expect = 1e-109, Method: Composition-based stats. Identities = 209/420 (49%), Positives = 292/420 (69%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +D+ +VGL+IGT+K+AA+V E P+G + ++G+GS PSRG+ KG V +++S V+ Sbjct 1 MSKRSDKNFIVGLDIGTSKIAAIVAETHPEGEIEVVGIGSHPSRGLKKGVVVNIDSTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AE MA CQI SV+ ++G HI QN G+VPI ++EVT EDVE V+ +A++V Sbjct 61 IQRAVEEAESMAGCQIYSVFTGIAGSHIRSQNSDGVVPIRDKEVTTEDVERVIDSARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LHV+PQE+ ID QEGI++PVG+SGVR++AKVHL+ A+NI+K + RCGL Sbjct 121 IPADQKILHVLPQEFIIDSQEGIRDPVGMSGVRLEAKVHLVFGAVSAAQNIIKCIRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 + D +I LASSYSVLT+DE+ELGVC+VDIGGGT DIAV+ GGA+RHT VIP AG+ VT Sbjct 181 EADDIILQQLASSYSVLTDDEQELGVCLVDIGGGTTDIAVFVGGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP A+ IK+R+ CAL + DE +EVPSVG RPPR L RQ LA VIEPR Sbjct 241 NDIAVALRTPTQHADDIKLRYACALTQLTHPDEHIEVPSVGDRPPRRLSRQALAGVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y E + + E+L++ G + L AG+VLTGG+A++EG+ A+ VFHT VR+G Sbjct 301 Y-------RELLELVMEELQRSGYEELLGAGVVLTGGSAKMEGVMELAEEVFHTPVRLGI 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++ GL D + P ++T +GLL +G H + R SV R+ W + F Sbjct 354 PQHMAGLPDVVRNPVHATGIGLLLFGH--HHPYTPGLGGRPLRSVRGVWDRMRGWFQGNF 411 >gi|89093035|ref|ZP_01165986.1| cell division protein FtsA [Oceanospirillum sp. MED92] gi|89082685|gb|EAR61906.1| cell division protein FtsA [Oceanospirillum sp. MED92] Length=431 Score = 399 bits (1024), Expect = 1e-109, Method: Composition-based stats. Identities = 207/416 (49%), Positives = 287/416 (68%), Gaps = 14/416 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++V L+IGT+KV LVGE+ DG ++I+G+GS PSRG+ KG V ++ES V +QRA+++A Sbjct 26 MIVALDIGTSKVVCLVGEINVDGSIDIVGIGSHPSRGLKKGVVVNIESTVSSIQRAVEEA 85 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C+I SV + ++G HI+ N G+V + + EVT D+E V+ A++V + + ++L Sbjct 86 ELMAGCKIHSVTVGIAGSHINSLNSHGIVAVRDREVTDYDLERVIDAARAVAIPADQKIL 145 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQEY ID EGI+ P+G+SGVR++AKVHL+T + A+NI K V RCGL+VD L+ Sbjct 146 HILPQEYEIDNSEGIREPLGMSGVRLEAKVHLVTGSVNAAQNIEKCVRRCGLEVDHLVLE 205 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASSYSVLTEDE+ELGVC+VDIGGGT DI+++TGGA+RHT VIP AG+ VT+DIA A Sbjct 206 QLASSYSVLTEDEKELGVCMVDIGGGTSDISIFTGGAIRHTAVIPIAGDQVTNDIAMALR 265 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IK+++ CAL + G DE++ VP VG RP R+L RQ LAEV+EPRY EL NLV Sbjct 266 TPMQHAEDIKIKYACALAQLAGPDETIMVPGVGDRPSRTLSRQALAEVVEPRYEELFNLV 325 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 Q +LR+ G + +AAGIVLTGG +++EG A+ +FH VR+ +P + G+ Sbjct 326 -------QAELRRSGFEDLVAAGIVLTGGTSKMEGAVELAEEIFHMPVRLASPHGVKGME 378 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEA----EVEKRVTASVGSWIKRLNSWLRKEF 420 D P Y+T +GLL Y + N A EVE SV I ++ +W + F Sbjct 379 DILGNPIYATGMGLLLYAHDDLGNEPAQEIPEVELVEQVSV---INKMKTWFQGNF 431 >gi|88799420|ref|ZP_01114997.1| cell division protein FtsA [Reinekea sp. MED297] gi|88777730|gb|EAR08928.1| cell division protein FtsA [Reinekea sp. MED297] Length=410 Score = 391 bits (1005), Expect = 2e-107, Method: Composition-based stats. Identities = 202/412 (49%), Positives = 287/412 (69%), Gaps = 10/412 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL+IGT+KV A+VG V +G + I+G+GS PSRG+ KG V ++ES ++ +QRAI++A Sbjct 9 MLVGLDIGTSKVVAIVGTVTAEGGLEIVGLGSHPSRGLKKGVVVNIESTIQSIQRAIEEA 68 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELM+ C I SVY+ ++G HIS N G+V I ++EV + D+E V+ AK+V + + +L Sbjct 69 ELMSGCDIHSVYVGIAGSHISSLNSNGIVAIKDKEVVEADLERVIDAAKAVAIPADQNIL 128 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQEY ID QEGIK P+G+ GVR++A+VH++T + +NI K V RCGL+VDQ+I Sbjct 129 HVLPQEYIIDSQEGIKEPLGMCGVRLEARVHMVTGAQNAVQNIDKCVRRCGLEVDQIILE 188 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LAS+ +VLT+DE+ELGVC+VDIGGGT D+AV+T GA+RHT VIP AG+ VT+DIA AF Sbjct 189 QLASAQAVLTDDEKELGVCLVDIGGGTTDMAVFTEGAIRHTAVIPIAGDQVTNDIAMAFA 248 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IK+++ CAL + G+ E+++VPSVG R R L RQ LAEV+EPRY EL +L+ Sbjct 249 TPTQHAEDIKIKYACALSQLAGEHETIKVPSVGDRSARELTRQALAEVVEPRYEELFSLI 308 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 E LR+ G + + AGIVLTGG A++EG A+ VFH VR+ +P ++GL+ Sbjct 309 KAE-------LRRSGFEDMIPAGIVLTGGTAKMEGAVELAEEVFHVPVRLASPQGVSGLS 361 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 D P ++T VGLL YG + +G+ + R S +W + W+ + F Sbjct 362 DVVNNPIHATGVGLLQYGLKQLHSGKKTMSSRSKTS--AW-QSFRKWIAENF 410 >gi|34499794|ref|NP_904009.1| Gene info cell division protein ftsA [Chromobacterium violaceum ATCC 12472] gi|34105644|gb|AAQ61998.1| Gene info cell division protein ftsA [Chromobacterium violaceum ATCC 12472] Length=404 Score = 390 bits (1001), Expect = 7e-107, Method: Composition-based stats. Identities = 199/412 (48%), Positives = 287/412 (69%), Gaps = 8/412 (1%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL+IGT+K+ A+V EVL DG +NI+G+G PSRG+ +G V ++ES V+ +QRA+++A Sbjct 1 MLVGLDIGTSKIVAIVAEVLEDGQLNIVGMGHTPSRGLKRGMVVNIESTVQAIQRALEEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMADC+I V++ ++G HI N GMV I + EVT+ D++ V+ TA++V + +H+VL Sbjct 61 ELMADCKIHEVFVGIAGSHIKSVNSHGMVAIKDREVTKMDIDRVIETARAVTIPPDHQVL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++ QEY+ID QEG++ P+G+SGVR++AKVH++T A+N+ K V RCGL+V L+ Sbjct 121 HILTQEYSIDGQEGVREPLGMSGVRLEAKVHIVTGAVSAAQNVTKCVRRCGLEVSDLVLQ 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 +AS+ +VL+EDE++LGVC++DIGGGT DIAVY GGA+RHT VIP AG+ +T+DIA A Sbjct 181 PMASAIAVLSEDEKDLGVCLIDIGGGTTDIAVYVGGAIRHTAVIPIAGDQITNDIAMALR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP +AE IK++HG L + + +EVP VG R PR + R TLAEVIEPR EL LV Sbjct 241 TPTKEAEDIKIQHGVGLVGMADPAQMIEVPGVGERGPRQMSRATLAEVIEPRVEELFQLV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 Q++LR+ G + L++G+VLTGGA+ + G+ A+ VFH VR+G P + GL Sbjct 301 -------QQELRRSGFEEMLSSGMVLTGGASLMPGMVELAEEVFHLPVRVGVPKYVGGLA 353 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + + P +ST VGLL YGK+ + G A K +A VG R+ +W F Sbjct 354 EVVKTPRFSTGVGLLLYGKD-QIQGYAGPVKAESAGVGQMFSRMKAWFGSNF 404 >gi|74316142|ref|YP_313882.1| Gene info Cell division protein FtsA [Thiobacillus denitrificans ATCC 25259] gi|74055637|gb|AAZ96077.1| Gene info Cell division protein FtsA [Thiobacillus denitrificans ATCC 25259] Length=411 Score = 386 bits (992), Expect = 8e-106, Method: Composition-based stats. Identities = 200/421 (47%), Positives = 284/421 (67%), Gaps = 11/421 (2%) Query 1 MIKATDRK-LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 M K D K LVVGL+IGT+K+ +VGE+ +GM+ IIG+G+ PSRG+ +G V ++E+ V Sbjct 1 MSKPRDPKNLVVGLDIGTSKIVCIVGEINDEGMLEIIGMGTHPSRGLRRGVVVNIEATVN 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 +QRA+++AELMADC+I VY ++G HI N GM I ++E++Q DV+ VV TA++V Sbjct 61 AIQRALEEAELMADCKIREVYTGIAGSHIKSFNSHGMFAIKDKEISQMDVDRVVETARAV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + ++LH IPQE+ +D QE +++P+G+S VR++ KVH++T A+NI+K V RCG Sbjct 121 NIPTDQQILHTIPQEFIVDGQEDVRDPLGMSAVRLEVKVHIVTGAVSAAQNIIKCVRRCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+V L+ LAS+ +VLTEDE+ELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ V Sbjct 181 LEVGDLVLQPLASAMAVLTEDEKELGVCLVDIGGGTTDIAVFTNGAIRHTAVIPVAGDQV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA A TPP +AE IKV++GCAL + + +EVP +G RPPR+L RQTLAE IEP Sbjct 241 NNDIAVALRTPPKEAEDIKVQYGCALRQLADARDMIEVPGIGDRPPRTLSRQTLAEFIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R EL +LV Q +LR+ G + L++GIV+TGG+A ++G+ + VFH VR+G Sbjct 301 RMEELYSLV-------QAELRRSGFEELLSSGIVITGGSAAMQGMVELGEEVFHMPVRMG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P L D P Y+T +GLL G E+ + K +S +R+ SW + Sbjct 354 WPRYEGALADVMHNPRYATCMGLLMAGLEAR---GRDAPKLSGSSFKDVFERMKSWFKGN 410 Query 420 F 420 F Sbjct 411 F 411 >gi|77814543|ref|ZP_00813801.1| Cell division protein FtsA [Shewanella putrefaciens CN-32] gi|77810373|gb|EAO94753.1| Cell division protein FtsA [Shewanella putrefaciens CN-32] Length=268 Score = 384 bits (986), Expect = 4e-105, Method: Composition-based stats. Identities = 184/268 (68%), Positives = 233/268 (86%), Gaps = 0/268 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSI 268 +DIA F TP S AE IKV+ CA S+ Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSM 268 >gi|78363218|gb|ABB41183.1| Gene info cell division protein FtsA [Thiomicrospira crunogena XCL-2] gi|78484932|ref|YP_390857.1| Gene info cell division protein FtsA [Thiomicrospira crunogena XCL-2] Length=417 Score = 384 bits (985), Expect = 6e-105, Method: Composition-based stats. Identities = 201/414 (48%), Positives = 284/414 (68%), Gaps = 10/414 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +V+GL+IGT+K+AA++G+V DG + ++G+G+ PS+G+ KG V +++S V+ +QRAID+A Sbjct 12 VVIGLDIGTSKIAAIIGKVKEDGSIEVVGMGTHPSKGLKKGVVVNIDSTVESIQRAIDEA 71 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 E M+ + SV + ++G HI N GMV IS +EV +EDV+ V+ A+++ + + VL Sbjct 72 ERMSGIKAESVSVGIAGSHIGSFNSNGMVAISNQEVQEEDVQRVIDAAQTIAIPGDQEVL 131 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQE+ ID Q GI+ P+G+SGVR++AKVH++T A+NI K VERC LKVD LI Sbjct 132 HILPQEFMIDNQGGIREPIGMSGVRLEAKVHMVTGSVSAAQNITKCVERCSLKVDNLILE 191 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VL+EDE+ELGVC+VDIGGGT DIA++ GA+RH+ VIP AG+ VT+DIA A Sbjct 192 QLASSEAVLSEDEKELGVCLVDIGGGTTDIAIFQNGAIRHSAVIPVAGDQVTNDIAMALR 251 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IK ++ CAL ++ +DE +EVPSVG RP R L R TL EVIEPRY EL L+ Sbjct 252 TPKQAAEDIKKKYACALPQLISQDEEIEVPSVGDRPARCLSRHTLVEVIEPRYEELFQLI 311 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 Q +LR+ ++ +AAGIVLTGG++ +EG A+ VFH VR+G P +++GL Sbjct 312 -------QAELRRTDFENKIAAGIVLTGGSSLVEGAVELAEEVFHMPVRLGMPHDVSGLK 364 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG--SWIKRLNSWLRKEF 420 + P ++T VGLL Y KE H EK S+ S I+++ SW K F Sbjct 365 EEVCNPSFATTVGLLMYAKE-HPGTRFSSEKTSELSLDKESIIEKMKSWFSKNF 417 >gi|29540760|gb|AAO89704.1| Gene info cell division protein FtsA [Coxiella burnetii RSA 493] gi|29653498|ref|NP_819190.1| Gene info cell division protein FtsA [Coxiella burnetii RSA 493] Length=410 Score = 384 bits (985), Expect = 6e-105, Method: Composition-based stats. Identities = 201/420 (47%), Positives = 283/420 (67%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D+ L+V L+IGT+K+AALVGEV D + +IG G+ PSRG+ +G V ++ES V+ Sbjct 1 MPKNPDKNLIVALDIGTSKIAALVGEVAQDNQIEVIGFGTHPSRGLKRGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C I S Y ++G HI N G+V I + EV Q DV+ V+ AK+V Sbjct 61 IQRAIEEAELMAGCDIHSAYTGIAGSHIRSLNSHGIVAIRDREVNQSDVDRVIDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEG++ PVG+SGVR++AKVH++T A+NI K V RCGL Sbjct 121 IPADQKILHILPQEFIIDNQEGVREPVGMSGVRLEAKVHIVTGAVSAAQNINKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V ++ LASS++VLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 QVGDIVLEQLASSHAVLTDDEKELGVCMVDIGGGTTDIAIFTEGAIRHTHVIPIAGDHVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +D+A A TP AE IK+++ L V +E+++VPSV RPP+ +Q++ LA+V+ R Sbjct 241 NDVAVALRTPTQYAEQIKIKYASVLPEEVNPEEAIQVPSVAKRPPKQVQKRALAQVVAAR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV E LR+ G + +AAGIVLTGGA+ I G A+R+F VR+G Sbjct 301 YEELFELVLAE-------LRRSGFEDLIAAGIVLTGGASHIAGCIELAERIFQMPVRLGL 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P + GL D P Y+TAVGLL +G +S LN + + S+ W +R+ SW + F Sbjct 354 PQYVNGLADVRDNPIYATAVGLLIHGHQSQLNNRPVFDLQHGMSL--W-QRMKSWFQGNF 410 >gi|53692772|ref|ZP_00122125.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus somnus 129PT] Length=592 Score = 380 bits (976), Expect = 6e-104, Method: Composition-based stats. Identities = 196/353 (55%), Positives = 262/353 (74%), Gaps = 1/353 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + + K+ VGLE+GT+KV A+VGE+LPDG+VN++G GSCPS+G+DKG + DL +VV Sbjct 1 MARIVEDKIFVGLEVGTSKVVAVVGELLPDGVVNVLGAGSCPSKGIDKGSITDLNAVVTS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID E +AD QI SV LA++G+HI NE G VPI+EEEVTQE+VE +HTA SVR Sbjct 61 IQRAIDSTEAVADSQIFSVTLAITGEHIQSLNENGFVPIAEEEVTQEEVEAALHTASSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D +LH+IPQE+A+D Q IK+P+GL GVR+ A+ HLI CH D N+ KAVERC L Sbjct 121 IGDGLALLHIIPQEFAVDKQVNIKDPLGLQGVRLSAQAHLIACHQDWLNNLKKAVERCKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV++++++G ASS +VLTEDE+ELGVC++D G GTMDI VYT G +R +KVIPYAGN VT Sbjct 181 KVNKVVYSGYASSQAVLTEDEKELGVCLIDFGAGTMDIVVYTNGFIRFSKVIPYAGNRVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGK-DESVEVPSVGGRPPRSLQRQTLAEVIEP 299 DIAYA T ++AE+IKV +G A+ + D+ +EV S+GGR PR + ++ L+ + Sbjct 241 DDIAYACATSRTEAESIKVAYGSAVSPPLDPLDKKIEVASIGGRAPRVISKEQLSIITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVF 352 RY ELL +V E+ QL+ +L + +K L AGIV+TGG AQIEGL CA +VF Sbjct 301 RYAELLGVVKSELDQLKYQLENKQIKFELIAGIVITGGGAQIEGLRECATQVF 353 >gi|89095255|ref|ZP_01168176.1| Cell division protein FtsA [Oceanospirillum sp. MED92] gi|89080462|gb|EAR59713.1| Cell division protein FtsA [Oceanospirillum sp. MED92] Length=413 Score = 377 bits (967), Expect = 7e-103, Method: Composition-based stats. Identities = 205/419 (48%), Positives = 284/419 (67%), Gaps = 11/419 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + ++V L+IGT+KV LVGEV DG ++IIG+GS SRG+ KG V ++ES V +QRA+ Sbjct 2 ENNMIVALDIGTSKVLCLVGEVGIDGTIDIIGIGSHASRGLKKGVVVNIESTVSSIQRAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 ++AELMA C+I SV + ++G HI+ N G+V + + EVT+ D+E V+ AK+V + + Sbjct 62 EEAELMAGCKIHSVTVGIAGSHINSMNSHGIVAVRDREVTEYDLERVIDAAKAVPIPADQ 121 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LHV+PQEY ID EGIK P+G+SGVR++AKVHL+T + A+NI K V RCGL+VD L Sbjct 122 KILHVLPQEYEIDGSEGIKEPLGMSGVRLEAKVHLVTGSVNAAQNIEKCVRRCGLEVDNL 181 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + LASSYSVLTEDE+ELGVC+VDIGGGT DI+++TGG++RHT VIP AG+ VT+DIA Sbjct 182 VLEQLASSYSVLTEDEKELGVCMVDIGGGTSDISIFTGGSIRHTAVIPIAGDQVTNDIAM 241 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 A TP AE IKV++ CAL + E+V+VP VG RP R L RQ+LAEV+EPRY EL Sbjct 242 ALRTPTQHAEDIKVKYACALAQLASAGETVKVPGVGDRPARDLSRQSLAEVVEPRYEELF 301 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ Q +LR+ G + +AAG+VLTGG +++EG A+ +FH VR+ P Sbjct 302 TLI-------QAELRRSGFEDLVAAGVVLTGGTSKMEGAVELAEEIFHMPVRLATPHGAR 354 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG----SWIKRLNSWLRKEF 420 G+ D P Y+T +GLL Y + H+ E V V S ++R+ +W + F Sbjct 355 GMEDILDSPIYATGIGLLQYARHDHVVAAEETTVGVNEVVNRPQVSVLERMKAWFQSNF 413 >gi|84369197|dbj|BAE70355.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|84625257|ref|YP_452629.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|58583446|ref|YP_202462.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] gi|58428040|gb|AAW77077.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] Length=411 Score = 375 bits (964), Expect = 1e-102, Method: Composition-based stats. Identities = 196/421 (46%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + D+ L+VGL+IGT+KV ALVGE P + +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGDKSLIVGLDIGTSKVVALVGEYSPGNPIEVIGIGSHESRGLKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+VPI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSPGIVPIRDGEVTWSDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ + HL+ C A NI K V++CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVQAHLVVCAQSAAANITKCVQKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L VD L+ + LASS +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LHVDDLVLSSLASSVAVLTADERELGVVLVDIGAGTTDLAVYVQGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQLATAEESIQVPSVGDRPPRRMPRHALAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEEMVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T GS K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQIEHPRRPSIP---TGRAGSLFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|78034820|emb|CAJ22465.1| Gene info cell division protein FtsA [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|21106905|gb|AAM35671.1| Gene info cell division protein [Xanthomonas axonopodis pv. citri str. 306] gi|21111742|gb|AAM40044.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66575139|gb|AAY50549.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. 8004] gi|78046390|ref|YP_362565.1| Gene info cell division protein FtsA [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|66769807|ref|YP_244569.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. 8004] gi|21241553|ref|NP_641135.1| Gene info cell division protein [Xanthomonas axonopodis pv. citri str. 306] gi|21230203|ref|NP_636120.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length=411 Score = 375 bits (964), Expect = 1e-102, Method: Composition-based stats. Identities = 196/421 (46%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + D+ L+VGL+IGT+KV ALVGE P + +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGDKSLIVGLDIGTSKVVALVGEYSPGNPIEVIGIGSHESRGLKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+VPI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSPGIVPIRDGEVTWSDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI K V++CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANITKCVQKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + LASS +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLASSVAVLTADERELGVVLVDIGAGTTDLAVYVQGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQLATAEESIQVPSVGDRPPRRMPRHALAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEEMVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T GS K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQIEHPRRPSIP---TGRAGSLFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|68214326|ref|ZP_00566150.1| Cell division protein FtsA [Methylobacillus flagellatus KT] gi|68187257|gb|EAN01947.1| Cell division protein FtsA [Methylobacillus flagellatus KT] Length=412 Score = 375 bits (962), Expect = 2e-102, Method: Composition-based stats. Identities = 196/418 (46%), Positives = 284/418 (67%), Gaps = 15/418 (3%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D+ L+VGL+IGT+K+ A+V E+ DG + +IG+G SRG+ KG V +++S V+ +QRA+ Sbjct 7 DKNLIVGLDIGTSKIVAIVAELQVDGSLKVIGLGQNTSRGLKKGVVVNIDSTVQAIQRAL 66 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 ++AELMADC+IS+VY ++G HI N GMV I + EVTQ DV+ V+ TA+++ + + Sbjct 67 EEAELMADCKISTVYTGIAGSHIKSLNSHGMVKIKDAEVTQMDVDRVIETARAIALPSDQ 126 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LH++ QE+ ID QE ++ P+G+SG++++ KVH++T A+NIVK ++RCGL+V L Sbjct 127 QILHILTQEFIIDGQEDVREPLGMSGMKLEVKVHIVTGAVSAAQNIVKCIKRCGLEVSDL 186 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I LASS +VLTEDE+ELGVC+VDIGGGT DIAV+ GA+RHT V+P AG+ +T+D+A Sbjct 187 ILQPLASSLAVLTEDEKELGVCLVDIGGGTTDIAVFKQGAIRHTAVVPIAGDQITNDVAV 246 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AF TP AE IK++HGCAL + E VEVP V GR PR L QTLAEVIEPR EL Sbjct 247 AFRTPTQSAEEIKIKHGCALRQLADAREVVEVPGVDGRDPRQLSVQTLAEVIEPRVVELY 306 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V E LR+ G++ +A+GIV+TGG++ ++G+ + +FH VR+G P N+ Sbjct 307 EFVLGE-------LRRSGMEEMIASGIVITGGSSLMKGMVELGEEIFHMPVRLGMPRNVG 359 Query 366 GLTDYAQEPYYSTAVGLLHYGK---ESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 GL++ P Y+T VGL+ G+ E L G+ E + S + R+ SW + F Sbjct 360 GLSEVVGNPRYATGVGLVLMGQQQVERQLQGQME-----SNSFSQVLSRMKSWFQGNF 412 >gi|56312266|emb|CAI06911.1| Gene info cell division protein FTSA [Azoarcus sp. EbN1] gi|56476223|ref|YP_157812.1| Gene info cell division protein FTSA [Azoarcus sp. EbN1] Length=409 Score = 372 bits (955), Expect = 1e-101, Method: Composition-based stats. Identities = 196/414 (47%), Positives = 275/414 (66%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV +V E PDG +N+IG+ + P+ G+ +G V ++E+ V + R I Sbjct 6 KDLVVGLDIGTAKVTCMVAESRPDGRLNVIGLATQPTSGLKRGVVVNIEATVDAIARVIQ 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 + E MA+C+I VY ++G HI N GMV I ++EVT DVE V+ A+++ + E + Sbjct 66 EVEQMAECKIRDVYTGIAGSHIKSFNSNGMVAIKDKEVTPLDVERVIEVARAMPIPAEQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID Q G++ P+G+SGV+++ KVH++T A+N++K V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQGGVREPIGMSGVKLEVKVHIVTGAVSAAQNVIKCVRRCGLEVMDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASSY+VLTEDE++LGVC+VDIGGGT DIAV+T GA+RHT V+P AG+ VT+DIA A Sbjct 186 LQPLASSYAVLTEDEKDLGVCLVDIGGGTTDIAVFTHGAIRHTAVLPIAGDQVTNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP S+AE IK+RHG AL ++ +E +EVP VG RPPR L RQ LA+VIEPR +EL Sbjct 246 LRTPTSEAEEIKIRHGVALHTLADPEEMIEVPGVGDRPPRPLSRQRLADVIEPRVSELFE 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q +LR+ G + L++G+VLTGG++ + G+ + VFH VRIG+P G Sbjct 306 LV-------QAELRRSGYEELLSSGVVLTGGSSMMLGMVELGEEVFHMPVRIGSPQYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D +P Y+ A+GL+ G G + R T SV R+ SW K F Sbjct 359 LADVVCQPRYANAMGLVMEGSAQRRRG---MLARETRSVRQVFGRMKSWFEKNF 409 >gi|71550341|ref|ZP_00670466.1| Cell division protein FtsA [Nitrosomonas eutropha C71] gi|71484440|gb|EAO17000.1| Cell division protein FtsA [Nitrosomonas eutropha C71] Length=412 Score = 371 bits (952), Expect = 3e-101, Method: Composition-based stats. Identities = 196/414 (47%), Positives = 277/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + ++VGL+IGT+K+ A+V E+ P+G IIG+GS PSRG+ KG V ++E+ V +QRA++ Sbjct 8 KNMIVGLDIGTSKIVAIVAEIKPEGGFEIIGLGSHPSRGLKKGVVVNIEATVNAIQRALE 67 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 + ELMA C+IS VY ++G HI N GMV I ++EVTQ DVE V+ TAK+V + + + Sbjct 68 EVELMAGCRISDVYAGIAGNHIKSFNSHGMVAIKDKEVTQADVEKVMETAKAVNIPADQQ 127 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ PVG+SG+R++ KVH++T A+NI K + RCGL V LI Sbjct 128 ILHILQQEFIIDGQEDVREPVGMSGIRLEVKVHIVTGAVSAAQNIAKCINRCGLDVRDLI 187 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS+ +VL+EDE++LGVC+VDIGGGT DIAV+T G++RHT VIP AG+ +T+DIA A Sbjct 188 LQPLASATAVLSEDEKDLGVCLVDIGGGTTDIAVFTDGSIRHTAVIPVAGDQITNDIAMA 247 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK R+G AL ++ E VEVP VG R R L RQTLAEVIEPR EL Sbjct 248 LRTPTKDAEDIKCRYGTALRTLADIREMVEVPDVGNRGVRPLSRQTLAEVIEPRVEELY- 306 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 L +Q +LR+ G + L++GIV+TGG++ + G+ + +FH VR+G P Sbjct 307 ------LLIQAELRRSGFEQLLSSGIVITGGSSSMLGMVELGEEIFHMPVRLGLPAYNGS 360 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + Q P YSTA+GL+ G E HL+ K + S + ++ SW ++ F Sbjct 361 LEEVVQTPRYSTAIGLVMAGMEDHLHHHQ--AKLKSGSTRQILAKMKSWFQENF 412 >gi|28199731|ref|NP_780045.1| Gene info cell division protein [Xylella fastidiosa Temecula1] gi|28057852|gb|AAO29694.1| Gene info cell division protein [Xylella fastidiosa Temecula1] gi|71898199|ref|ZP_00680373.1| Cell division protein FtsA [Xylella fastidiosa Ann-1] gi|71731938|gb|EAO33995.1| Cell division protein FtsA [Xylella fastidiosa Ann-1] Length=411 Score = 369 bits (946), Expect = 2e-100, Method: Composition-based stats. Identities = 191/421 (45%), Positives = 281/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQMERPRRPSLP---TGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|71163927|gb|EAO13642.1| Cell division protein FtsA [Xylella fastidiosa Dixon] gi|71275118|ref|ZP_00651405.1| Cell division protein FtsA [Xylella fastidiosa Dixon] Length=411 Score = 369 bits (946), Expect = 2e-100, Method: Composition-based stats. Identities = 191/421 (45%), Positives = 281/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVCNPVHASGVGLLLMGSQMERPRRPSLP---TGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|87122623|ref|ZP_01078500.1| cell division protein FtsA [Marinomonas sp. MED121] gi|86162081|gb|EAQ63369.1| cell division protein FtsA [Marinomonas sp. MED121] Length=420 Score = 365 bits (937), Expect = 2e-99, Method: Composition-based stats. Identities = 193/427 (45%), Positives = 285/427 (66%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL++GT+KV LVGEV+ DG + I+G+GS ++GM +G V ++ES V+ +QRA+++A Sbjct 1 MIVGLDVGTSKVVCLVGEVMADGRLEIVGIGSHAAKGMKRGAVINIESTVQSIQRAVEEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C I SVY++++G HI N G+V + + EV + D+E V+ A++V + + RVL Sbjct 61 ELMAGCNIHSVYVSVAGSHIRSLNSHGIVAVKDGEVHEADIERVIDAAQAVPIPSDQRVL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQEY+ID QEGIK+P G+SGVR++A VHLI+ + NI K ++RCGL VD +I + Sbjct 121 HILPQEYSIDSQEGIKDPSGMSGVRLEANVHLISGAANAVMNIEKCIKRCGLGVDGVILS 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS+S L++DE++LGVC+VDIG GT D+AV+ GA+ HT V+P AG+ VT+DI+ A Sbjct 181 QLASSHSSLSDDEKDLGVCLVDIGAGTADMAVWIDGAIHHTSVVPVAGDQVTNDISMALR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IKV++ CAL S+ G D+++EVPSVG R RS+ R LAEV+E RY E+ +LV Sbjct 241 TPTQHAENIKVQYACALSSLAGADQNIEVPSVGDRQSRSISRHALAEVVEARYEEIFSLV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +E LR+ G + AGIV+TGG + +EG A+RVF VR+ P+++ G++ Sbjct 301 LDE-------LRRSGYAERIPAGIVVTGGTSLMEGATELAERVFDMPVRMSVPVSVKGMS 353 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAE--------------VEKRVTASVGSWIKR-LN 413 D P +ST VGL+ YG + G A+ V+ TA + + R + Sbjct 354 DIVDNPIFSTGVGLIMYGIDESDLGMAQQHVSSLKVEESKHSVKSESTAEAANKMWRNMK 413 Query 414 SWLRKEF 420 SW++ F Sbjct 414 SWVKSNF 420 >gi|9105699|gb|AAF83611.1| Gene info cell division protein [Xylella fastidiosa 9a5c] gi|15837403|ref|NP_298091.1| Gene info cell division protein [Xylella fastidiosa 9a5c] Length=411 Score = 365 bits (937), Expect = 2e-99, Method: Composition-based stats. Identities = 190/421 (45%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVGNAVHASGVGLLLMGSQMERPRRPSLP---TGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|52629927|gb|AAU28668.1| Gene info cell division protein FtsA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52842816|ref|YP_096615.1| Gene info cell division protein FtsA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length=420 Score = 363 bits (933), Expect = 6e-99, Method: Composition-based stats. Identities = 188/420 (44%), Positives = 271/420 (64%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K ++ ++ GL+IGT+K+ AL+GEV DG + IIG+G PSRG+ +G V D+E+ V Sbjct 9 MAKKIEKNIITGLDIGTSKIIALIGEVTSDGTIEIIGIGRHPSRGLKRGVVVDIETTVNS 68 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+ +AELMA C++ +VY ++G HI N G+V I ++EV+Q DVE V+ AK+V Sbjct 69 IQRAVQEAELMAGCEVRTVYAGIAGSHIRSLNSHGIVAIRDQEVSQADVERVIDAAKAVA 128 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID+Q I+ P+G++GVR++++VH++T A+NIVK V RCGL Sbjct 129 IPADQKILHILPQEFIIDHQGSIREPIGMAGVRLESRVHIVTGSVSAAQNIVKCVRRCGL 188 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V +I LASS++VLTEDE+ELGVC++DIGGGT DIA++ GA++HT VIP AG+ VT Sbjct 189 DVIDIILEQLASSHAVLTEDEKELGVCLIDIGGGTTDIAIFCEGAIQHTSVIPIAGDQVT 248 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEAIKV H CAL + ++ +EV SV RP R + + LA+V+ R Sbjct 249 NDIAMALRTPTKAAEAIKVNHACALPELANPNQMLEVTSVNDRPGRKISAKALADVVSAR 308 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +LV E LR+ G + LAAGIVLTGGA+ + G A+ F VR G Sbjct 309 YEELFSLVRNE-------LRRSGFEDRLAAGIVLTGGASNVRGAIELAELCFEMPVRKGC 361 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++GLT+ + P ++T VGLL +G + V W R+ W + F Sbjct 362 AHYVSGLTEATENPSFATGVGLLLHGFQQQYESGYNVPAMNDNGKSIW-SRMKEWFQGNF 420 >gi|53755279|emb|CAH16773.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Lens] gi|53752384|emb|CAH13816.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Paris] gi|54298599|ref|YP_124968.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Paris] gi|54295447|ref|YP_127862.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Lens] Length=412 Score = 363 bits (933), Expect = 6e-99, Method: Composition-based stats. Identities = 188/420 (44%), Positives = 271/420 (64%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K ++ ++ GL+IGT+K+ AL+GEV DG + IIG+G PSRG+ +G V D+E+ V Sbjct 1 MAKKIEKNIITGLDIGTSKIIALIGEVTSDGTIEIIGIGRHPSRGLKRGVVVDIETTVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+ +AELMA C++ +VY ++G HI N G+V I ++EV+Q DVE V+ AK+V Sbjct 61 IQRAVQEAELMAGCEVRTVYAGIAGSHIRSLNSHGIVAIRDQEVSQADVERVIDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID+Q I+ P+G++GVR++++VH++T A+NIVK V RCGL Sbjct 121 IPADQKILHILPQEFIIDHQGSIREPIGMAGVRLESRVHIVTGSVSAAQNIVKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V +I LASS++VLTEDE+ELGVC++DIGGGT DIA++ GA++HT VIP AG+ VT Sbjct 181 DVIDIILEQLASSHAVLTEDEKELGVCLIDIGGGTTDIAIFCEGAIQHTSVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEAIKV H CAL + ++ +EV SV RP R + + LA+V+ R Sbjct 241 NDIAMALRTPTKAAEAIKVNHACALPELANPNQMLEVTSVNDRPGRKISAKALADVVSAR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +LV E LR+ G + LAAGIVLTGGA+ + G A+ F VR G Sbjct 301 YEELFSLVRNE-------LRRSGFEDRLAAGIVLTGGASNVRGAIELAELCFEMPVRKGC 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++GLT+ + P ++T VGLL +G + V W R+ W + F Sbjct 354 AHYVSGLTEATENPSFATGVGLLLHGFQQQYESGYNVPAMNDNGKSIW-SRMKEWFQGNF 412 >gi|71848727|gb|AAZ48223.1| Gene info Cell division protein FtsA [Dechloromonas aromatica RCB] gi|71909106|ref|YP_286693.1| Gene info Cell division protein FtsA [Dechloromonas aromatica RCB] Length=409 Score = 363 bits (932), Expect = 6e-99, Method: Composition-based stats. Identities = 190/415 (45%), Positives = 273/415 (65%), Gaps = 10/415 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 ++ LVVGL+IGT+K+ ALV E+ +G +N+IG+GS SRG+ KG V ++E V + R I Sbjct 5 NKDLVVGLDIGTSKIVALVAEINNEGNLNVIGMGSQDSRGLKKGVVVNIEDTVHTISRVI 64 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 + ELMADC++S+VY ++G HI N GMV I ++EVT DVE V+ TA+++ + + Sbjct 65 QEVELMADCKVSNVYTGIAGSHIKSFNSNGMVAIKDKEVTPSDVERVIETARAMPIPADQ 124 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 +LH++ QE+ ID Q+GI+ P+G+SG+R++ K H++T A+NIVK V RCGL+V+ L Sbjct 125 EILHILTQEFVIDGQDGIREPIGMSGMRLEVKTHIVTGAVSAAQNIVKCVRRCGLEVNDL 184 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + LASSY+VL+EDE++LGVC++DIGGGT DIAV+T GA+RHT VIP AG+ +T+DIA Sbjct 185 VLQPLASSYAVLSEDEKDLGVCLIDIGGGTTDIAVWTQGAIRHTSVIPIAGDQITNDIAM 244 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 A TP +AE IK ++GCAL + E++EV V RP R L R+ LA+VI+PR EL Sbjct 245 ALRTPTREAEDIKCKYGCALSQLADAAENMEVAGVDDRPSRKLSRRALADVIQPRVEELY 304 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ Q +LR+ G + L++GIVLTGGA+ + G+ + +FH VR+G P Sbjct 305 ELI-------QNELRRAGFEEVLSSGIVLTGGASVMPGMVELGEEIFHMPVRLGNPKYTG 357 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D Q P +ST+ GLL + G+ EK+ V +K SW K F Sbjct 358 SLADVVQSPRFSTSFGLLLEAQAQRKRGQKIQEKQGFKDVFDGMK---SWFAKNF 409 >gi|82703604|ref|YP_413170.1| Gene info cell division protein FtsA [Nitrosospira multiformis ATCC 25196] gi|82411669|gb|ABB75778.1| Gene info cell division protein FtsA [Nitrosospira multiformis ATCC 25196] Length=412 Score = 362 bits (928), Expect = 2e-98, Method: Composition-based stats. Identities = 195/415 (46%), Positives = 278/415 (66%), Gaps = 11/415 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVG++IGT+K+ +V E+ P+G +IG+GS PSRG+ KG V ++++ V +QRA++ Sbjct 8 KNLVVGIDIGTSKIVTVVAEMKPEGGYTVIGMGSHPSRGLKKGVVVNIDATVNAIQRALE 67 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I VY ++G HI N GMVPI +EV+++DVE V+ TAK+V + ++ + Sbjct 68 EAELMADCKIREVYTGIAGSHIKSFNSHGMVPIKNKEVSRQDVERVMETAKAVNILNDQQ 127 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLHV+ QE+ ID QE + P+G+SGVR++ KVH++T +NI+K V RCGL+V L+ Sbjct 128 VLHVLNQEFIIDEQEDVLEPIGMSGVRLEVKVHIVTGSVSAVQNILKCVRRCGLEVRDLV 187 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS+ +VL+EDE++LGVC++DIGGGT DIA++T GA+RHT VIP AG+ +T+DIA A Sbjct 188 LQPLASAMAVLSEDEKDLGVCLLDIGGGTTDIAIFTRGAIRHTAVIPIAGDQITNDIALA 247 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T PSDAE IK R+GCAL S+ E VEV VG R R L RQTLAEVIEPR EL + Sbjct 248 LRTSPSDAEDIKCRYGCALRSMADPHEMVEVAGVGNRSVRHLSRQTLAEVIEPRVEELYS 307 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q +LR+ G + L++GIV+TGG++ +EG+ + +FH VR+G P Sbjct 308 LV-------QAELRRSGFEELLSSGIVITGGSSSLEGMVELGEEIFHMPVRLGLPKYHGS 360 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWI-KRLNSWLRKEF 420 L + P ST +GL+ G + E + R+ + S I R+ SW + F Sbjct 361 LEEVVVTPRCSTGIGLILAGVDQLQQHE---QTRLEGNSFSRILDRMKSWFQVNF 412 >gi|52429463|gb|AAU50056.1| Gene info cell division protein FtsA [Burkholderia mallei ATCC 23344] gi|76581316|gb|ABA50791.1| Gene info cell division protein FtsA [Burkholderia pseudomallei 1710b] gi|76811863|ref|YP_334910.1| Gene info cell division protein FtsA [Burkholderia pseudomallei 1710b] gi|83720984|ref|YP_441670.1| Gene info cell division protein FtsA [Burkholderia thailandensis E264] gi|53726040|ref|YP_104090.1| Gene info cell division protein FtsA [Burkholderia mallei ATCC 23344] gi|83654809|gb|ABC38872.1| Gene info cell division protein FtsA [Burkholderia thailandensis E264] gi|87314929|ref|ZP_01095965.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 2002721280] gi|67761837|ref|ZP_00500543.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei S13] gi|67755851|ref|ZP_00494741.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei Pasteur] gi|67737674|ref|ZP_00488423.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 668] gi|85065688|ref|ZP_01026541.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 10229] gi|67684771|ref|ZP_00478698.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1710a] gi|67673292|ref|ZP_00470059.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1655] gi|84523721|ref|ZP_01010857.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei SAVP1] gi|67649132|ref|ZP_00447358.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei NCTC 10247] gi|67643625|ref|ZP_00442370.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei GB8 horse 4] gi|67637729|ref|ZP_00436667.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 10399] gi|83680174|ref|ZP_00941882.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 406e] gi|83625696|ref|ZP_00935926.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei JHU] gi|83621163|ref|ZP_00931575.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei FMH] gi|82535386|ref|ZP_00894404.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1106b] gi|82531156|ref|ZP_00890378.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1106a] Length=410 Score = 362 bits (928), Expect = 2e-98, Method: Composition-based stats. Identities = 195/414 (47%), Positives = 275/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAVVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + + S G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGSAGQIFSRMKEWFLSNF 410 >gi|30138616|emb|CAD84907.1| Gene info Cell division protein FtsA [Nitrosomonas europaea ATCC 19718] gi|30248999|ref|NP_841069.1| Gene info Cell division protein FtsA [Nitrosomonas europaea ATCC 19718] Length=412 Score = 361 bits (927), Expect = 3e-98, Method: Composition-based stats. Identities = 193/414 (46%), Positives = 276/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+K+ A+V E+ P+G IIG+GS SRG+ KG V ++E+ V +QRA++ Sbjct 8 KDLIVGLDIGTSKIVAIVAEMKPEGGFEIIGLGSHLSRGLKKGVVVNIEATVNAIQRALE 67 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 + ELMA C+IS VY ++G HI N GMV I ++EVTQ DVE V+ TAK+V + + + Sbjct 68 EVELMAGCRISEVYAGIAGNHIRGFNSHGMVAIKDKEVTQADVEKVMETAKAVNIPADQQ 127 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ PVG+SG+R++ KVH++T A+NI K + RCGL V L+ Sbjct 128 ILHILNQEFIIDGQEDVREPVGMSGIRLEVKVHIVTGAVSAAQNIAKCIHRCGLDVRDLV 187 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS+ +VL+EDE++LGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ +T+DIA A Sbjct 188 LQPLASAKAVLSEDEKDLGVCLVDIGGGTTDIAVFTDGAIRHTAVIPVAGDQITNDIAMA 247 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK R+G AL ++ E VEVP VG R R L RQTLAEVIEPR EL Sbjct 248 LRTPTKDAEDIKCRYGIALRTLADIREMVEVPDVGNRGARPLSRQTLAEVIEPRVEELY- 306 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 L +Q +LR+ G + L++GIV+TGG++ + G+ + +FH VR+G P+ Sbjct 307 ------LLIQAELRRSGFEQLLSSGIVITGGSSSMLGMVELGEEIFHMPVRLGLPVYNGS 360 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P YSTA+GL+ G E L+ K ++S + ++ W ++ F Sbjct 361 LEEVVRTPRYSTAIGLVMVGMEDRLHHHQ--AKLKSSSTRQILAKMKGWFQENF 412 >gi|48781047|ref|ZP_00277701.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia fungorum LB400] Length=410 Score = 360 bits (925), Expect = 4e-98, Method: Composition-based stats. Identities = 192/414 (46%), Positives = 276/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE +EVP +G R PR+L RQ LA V+EPR EL + Sbjct 246 LRTPTPDAEDIKVDYGIAKQALADPDEMIEVPGLGERGPRTLSRQALAAVVEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGA+ + G+ + +F VRIG P G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGASMMLGMVELGEDIFLKPVRIGVPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G+ + G + + S+G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGRSQRMRGRKVAVQ--SGSMGQVFTRMKDWFLGNF 410 >gi|52211045|emb|CAH37033.1| Gene info cell division protein FtsA [Burkholderia pseudomallei K96243] gi|53720631|ref|YP_109617.1| Gene info cell division protein FtsA [Burkholderia pseudomallei K96243] Length=410 Score = 360 bits (924), Expect = 6e-98, Method: Composition-based stats. Identities = 194/414 (46%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ + +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAVVAELKGESHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + + S G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGSAGQIFSRMKEWFLSNF 410 >gi|39985101|gb|AAR36456.1| Gene info cell division protein FtsA [Geobacter sulfurreducens PCA] gi|39998155|ref|NP_954106.1| Gene info cell division protein FtsA [Geobacter sulfurreducens PCA] Length=411 Score = 359 bits (921), Expect = 1e-97, Method: Composition-based stats. Identities = 184/381 (48%), Positives = 266/381 (69%), Gaps = 8/381 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT K+ A+VG V DG ++I+G+G+ PSRGM KG V ++ES V+ +++A+ +A Sbjct 8 LIVGLDIGTTKICAIVGNVTEDG-IDIVGIGTSPSRGMRKGVVINIESTVESIKKAVSEA 66 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C I SVY ++G HI N G++ I EV+ EDV+ V+ AK++ + + V+ Sbjct 67 ELMAGCDIRSVYAGIAGGHIKGINSQGVIAIKNREVSSEDVKRVIDAAKAIAIPMDREVI 126 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQE+ ID Q+GI+ P+G+SGVR++A+VH++T A+NI+KA R GL V ++ Sbjct 127 HILPQEFIIDDQDGIREPLGMSGVRLEARVHIVTGAVASAQNIIKACNRAGLDVADIVLE 186 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS SVL+ DE+ELGV ++DIGGGT DIA++ GA++HT V+ GN +T+DIA Sbjct 187 QLASSESVLSADEKELGVALIDIGGGTTDIAIFVDGAIKHTAVLSLGGNHLTNDIAVGLR 246 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP ++AE IK ++GC + S+VGKDE++EVPSVGGR PR L RQ LAE++EPR E+ LV Sbjct 247 TPMAEAEKIKQKYGCCMASMVGKDETIEVPSVGGRKPRVLSRQLLAEILEPRVEEIFTLV 306 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 N EI+ + G + +A+GIV+TGG +EG+ A++VF+ VR G P I GLT Sbjct 307 NREIV-------KSGFEDLIASGIVITGGTTILEGMPELAEQVFNLPVRRGLPQQIGGLT 359 Query 369 DYAQEPYYSTAVGLLHYGKES 389 D P Y+T VGL+ YG ++ Sbjct 360 DVVNSPVYATGVGLVVYGSKN 380 >gi|78192892|gb|ABB30659.1| Gene info Cell division protein FtsA [Geobacter metallireducens GS-15] gi|78221637|ref|YP_383384.1| Gene info Cell division protein FtsA [Geobacter metallireducens GS-15] Length=411 Score = 359 bits (921), Expect = 1e-97, Method: Composition-based stats. Identities = 186/388 (47%), Positives = 268/388 (69%), Gaps = 8/388 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + A L+VGL+IGT K+ A+VG V DG ++I+G+GS PSRGM KG V ++ES V+ + Sbjct 1 MSARRDNLIVGLDIGTTKICAIVGNVTEDG-IDIVGIGSSPSRGMRKGVVINIESTVESI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+ +AELMA C+I SVY ++G HI N G++ I EVT EDV+ V+ AK++ + Sbjct 60 KKAVSEAELMAGCEIRSVYAGIAGGHIKGFNSQGVIAIKNREVTSEDVKRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NIVKA R GL Sbjct 120 PMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIVKACNRAGLD 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE+ELGV +VDIGGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEQLASSEAVLSADEKELGVALVDIGGGTTDIAIFVDGAIKHTSVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GC + S+VGK+E++EVPSVGGR PR L RQ LAE++EPR Sbjct 240 DIAVGLRTPMAEAEKIKQKYGCCMASLVGKEETIEVPSVGGRKPRVLSRQLLAEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G + +A+G+V+TGG +EG+ A++VF+ VR G P Sbjct 300 EEIFTLVNREIM-------KSGFEDLIASGVVITGGTTILEGMPELAEQVFNLPVRRGMP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKES 389 I GL D P Y+T VGL+ YG ++ Sbjct 353 QQIGGLVDVVNSPVYATGVGLVVYGSKN 380 >gi|84360668|ref|ZP_00985364.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia dolosa AUO158] Length=410 Score = 358 bits (920), Expect = 2e-97, Method: Composition-based stats. Identities = 192/414 (46%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + + G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGNAGQIFSRMKEWFLSNF 410 >gi|74020125|ref|ZP_00690731.1| Cell division protein FtsA [Burkholderia ambifaria AMMD] gi|72607163|gb|EAO43129.1| Cell division protein FtsA [Burkholderia ambifaria AMMD] Length=461 Score = 358 bits (919), Expect = 3e-97, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 57 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 116 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 117 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 176 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 177 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 236 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 237 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 296 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 297 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 356 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 357 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 409 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + + G R+ W F Sbjct 410 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGNAGQIFSRMKEWFLSNF 461 >gi|77965870|gb|ABB07250.1| Gene info Cell division protein FtsA [Burkholderia sp. 383] gi|78065125|ref|YP_367894.1| Gene info Cell division protein FtsA [Burkholderia sp. 383] gi|67662064|ref|ZP_00459355.1| Cell division protein FtsA [Burkholderia cenocepacia HI2424] gi|67660712|ref|ZP_00458052.1| Cell division protein FtsA [Burkholderia cenocepacia AU 1054] gi|84356657|ref|ZP_00981496.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia cenocepacia PC184] gi|67104649|gb|EAM21768.1| Cell division protein FtsA [Burkholderia cenocepacia HI2424] gi|67091702|gb|EAM09271.1| Cell division protein FtsA [Burkholderia cenocepacia AU 1054] Length=410 Score = 358 bits (918), Expect = 3e-97, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 275/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + + + G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGNAGQVFSRMKEWFLSNF 410 >gi|71836424|ref|ZP_00676193.1| Cell division protein FtsA [Pelobacter propionicus DSM 2379] gi|71743254|gb|EAO38403.1| Cell division protein FtsA [Pelobacter propionicus DSM 2379] Length=412 Score = 358 bits (918), Expect = 3e-97, Method: Composition-based stats. Identities = 188/420 (44%), Positives = 278/420 (66%), Gaps = 9/420 (2%) Query 2 IKATDR-KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 + AT R L+VGL+IGT K+ A+VG V DG ++I+G+G+ PS G+ +G V ++ES V Sbjct 1 MSATRRDNLIVGLDIGTTKICAIVGNVTEDG-IDIVGIGTSPSSGLRRGVVINIESTVGA 59 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +++AI++AELMA C+I SVY ++G HI N G++ I EV QED+ V+ AK++ Sbjct 60 IRKAINEAELMAGCEIKSVYAGIAGGHIRGTNSQGVIAIKNREVNQEDIRRVIDAAKAIA 119 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NIVK+ R GL Sbjct 120 IPMDREVIHILPQEFIIDEQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIVKSCNRTGL 179 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V ++ LASS +VL+ DE+ELGVC+VDIGGGT DIA++ GA+++T V+ GN +T Sbjct 180 DVADIVLEQLASSEAVLSADEKELGVCLVDIGGGTTDIAIFADGAIKYTSVLSLGGNHLT 239 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA TP ++AE IK ++GC L S+VGKD+ +EVPSVGGR PR L R L E++ PR Sbjct 240 NDIAVGLRTPMAEAEKIKQKYGCCLSSLVGKDDKIEVPSVGGRKPRELSRNVLCEILGPR 299 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+ +LVN EI+ + G++ +A+G+V+TGG + +EG+ A+++F+ VR G Sbjct 300 VEEIFSLVNREII-------KSGLEDSIASGVVITGGTSILEGMPELAEQIFNLPVRRGV 352 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P I GL D P Y+T VGL+ YG + E K GS + R+ SW + F Sbjct 353 PQRIGGLIDVVNSPVYATGVGLVVYGSRNSGAREFPSVKPENKLFGSVLGRMKSWFGEFF 412 >gi|67548901|ref|ZP_00426780.1| Cell division protein FtsA [Burkholderia vietnamiensis G4] gi|67529786|gb|EAM26642.1| Cell division protein FtsA [Burkholderia vietnamiensis G4] Length=410 Score = 357 bits (917), Expect = 4e-97, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + + G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQ--SGNAGQIFSRMKEWFLSNF 410 >gi|68247429|gb|EAN29515.1| Cell division protein FtsA [Magnetococcus sp. MC-1] gi|69256637|ref|ZP_00606131.1| Cell division protein FtsA [Magnetococcus sp. MC-1] Length=412 Score = 354 bits (909), Expect = 3e-96, Method: Composition-based stats. Identities = 183/411 (44%), Positives = 264/411 (64%), Gaps = 7/411 (1%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D+ L++GL+IGT K+ +V +V PDG ++IIG+G+ PSRG+ KG V D++S V+ ++ A+ Sbjct 5 DQNLIIGLDIGTTKICCIVADVQPDGRLDIIGLGTHPSRGLRKGVVIDIDSTVESIRMAV 64 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 ++AE+MA +I VY ++G HI+ N G+V + EV D++ V+ A++ + + Sbjct 65 EEAEMMAGVEIRMVYAGIAGAHIASNNSEGVVATKDNEVHASDIQRVLDAARAQSIPMDR 124 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 +LHVIPQE+ +D QEGIK+P+G++GVR++A+VHL+T A+NIVK RCGL V + Sbjct 125 EILHVIPQEFVLDAQEGIKDPLGMAGVRLEARVHLVTGAVASAQNIVKCANRCGLDVGDI 184 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I LAS+ + LTEDE+ELG C++DIGGGT DIA+Y G ++HT V+ G+ +T+DIA Sbjct 185 ILEQLASAEACLTEDEKELGCCLLDIGGGTTDIAIYAEGHIKHTAVLAIGGDHMTNDIAV 244 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 TP +AE +K + GCAL ++VG DE++EVPS+G RPPRSL R LAE+IEPR EL Sbjct 245 GLRTPTREAEQLKRKFGCALSALVGPDETIEVPSIGERPPRSLGRHILAEIIEPRVEELF 304 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV EI+ + G +AAGIVLTGGAA EG+ A+ +F+ VR G P + Sbjct 305 TLVQREIV-------RSGFDEQIAAGIVLTGGAANTEGIVDLAEEIFNKPVRRGLPQGVG 357 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 GLTD Y+TA GL+ Y + S + R+ SW Sbjct 358 GLTDVIANASYATATGLVLYANRYGQESTMRYNQDDVGGSRSMVSRMRSWF 408 >gi|33568800|emb|CAE34558.1| Gene info cell division protein FtsA [Bordetella bronchiseptica RB50] gi|33566816|emb|CAE39031.1| Gene info cell division protein FtsA [Bordetella parapertussis] gi|33564024|emb|CAE43290.1| Gene info cell division protein FtsA [Bordetella pertussis Tohama I] gi|33593950|ref|NP_881594.1| Gene info cell division protein FtsA [Bordetella pertussis Tohama I] gi|33598258|ref|NP_885901.1| Gene info cell division protein FtsA [Bordetella parapertussis 12822] gi|33603169|ref|NP_890729.1| Gene info cell division protein FtsA [Bordetella bronchiseptica RB50] Length=408 Score = 353 bits (906), Expect = 7e-96, Method: Composition-based stats. Identities = 189/413 (45%), Positives = 269/413 (65%), Gaps = 15/413 (3%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+LP+G ++G+G SRGM KG V ++E+ V +QRA++ Sbjct 6 KDLIVALDIGTSKVVAVVAEILPEGRFEVLGLGQHESRGMRKGVVVNIETTVNSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I VY ++G HI N GMV + ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKIRDVYAGIAGSHIRSFNSSGMVAVKDKEVTATDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLHV+ QE+ +D QE I+ P+G+SG+R++ +VH++T A+NIVK V RCGL+V LI Sbjct 126 VLHVLTQEFIVDGQEDIREPIGMSGLRLEVRVHIVTGAVSAAQNIVKCVRRCGLEVQDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS + LT DE+ELGV +VDIGGGT D+A++TGGA+RHT VIP AG+ +T+DIA Sbjct 186 LQPLASSLACLTADEKELGVVLVDIGGGTTDVAIFTGGAIRHTAVIPIAGDQITNDIAAM 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+R+G A + DE+VEVP +G R PR ++RQ L VIEPR EL Sbjct 246 LRTPTPDAEEIKLRYGVAKQVLARPDEAVEVPGLGDRGPRQVKRQALGAVIEPRVEELFT 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 L+ Q+ +R G + LA+G+VLTGG+AQ+ G+ A+ VF VR+ P Sbjct 306 LI-------QQVVRDSGYEDLLASGVVLTGGSAQMPGMIELAEDVFLKPVRVAVPEYEGS 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSW---IKRLNSWL 416 L D + P +ST +GLL + L G ++V A G++ + R+ W Sbjct 359 LADVMRNPRFSTVMGLLQEARMQRLRG-----RKVAAQTGNFKTLLARMKEWF 406 >gi|88937535|ref|ZP_01143097.1| Cell division protein FtsA [Geobacter uraniumreducens Rf4] gi|88915717|gb|EAR34974.1| Cell division protein FtsA [Geobacter uraniumreducens Rf4] Length=411 Score = 350 bits (899), Expect = 5e-95, Method: Composition-based stats. Identities = 184/422 (43%), Positives = 281/422 (66%), Gaps = 14/422 (3%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + A L+VGL+IGT K+ A+VG + +G ++I+G+G+ PSRG+ KG V ++ES V + Sbjct 1 MSAKRDNLIVGLDIGTTKICAIVGNLTEEG-IDIVGIGTSPSRGLRKGVVINIESTVASI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+++AELMA C+I SVY ++G HI N G++ I EV +DV+ V+ AK++ + Sbjct 60 RKAVEEAELMAGCEIKSVYAGIAGGHIKGFNSQGVIAIKNREVCSDDVKRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NI+K+ R GL Sbjct 120 PMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIIKSCNRAGLD 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE+ELGV +VD+GGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEQLASSEAVLSADEKELGVALVDVGGGTTDIAIFVDGAIKHTSVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GC + S+VGKDE++EVPSVGGR PR L RQ L+E++EPR Sbjct 240 DIAVGLRTPMAEAEKIKQKYGCCMASLVGKDETIEVPSVGGRKPRILSRQLLSEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G++ +A+G+V+TGG+ +EG+ A++VF+ VR G P Sbjct 300 EEIFTLVNREIV-------KSGLEDLIASGVVITGGSTILEGMPELAEQVFNLPVRRGLP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKES---HLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 I GL D P Y+T VGL+ YG ++ H A+ E + V +R+ W + Sbjct 353 QRIGGLVDVVNSPAYATGVGLVVYGSKNVGVHEFPSAQSEDNIFRKVS---RRMKEWFGE 409 Query 419 EF 420 F Sbjct 410 FF 411 >gi|17429863|emb|CAD16547.1| Gene info PROBABLE CELL DIVISION PROTEIN FTSA [Ralstonia solanacearum] gi|17547559|ref|NP_520961.1| Gene info PROBABLE CELL DIVISION PROTEIN FTSA [Ralstonia solanacearum GMI1000] Length=410 Score = 347 bits (891), Expect = 4e-94, Method: Composition-based stats. Identities = 187/418 (44%), Positives = 272/418 (65%), Gaps = 17/418 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KV A+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVVAVVAELRPDGAYEVIGMGQTESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS V+ ++G HI N GMV I ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKISEVFTGIAGSHIRSFNSSGMVAIKDKEVTPADVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIG GT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGSGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G A + DE ++VP VG R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKIQYGIAKQVLADPDEMIDVPGVGDRGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ + R+ G + L++G+VLTGG A + G+ + +F VR+G P Sbjct 306 LVHQVV-------RESGYEELLSSGVVLTGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS----WIKRLNSWLRKEF 420 L + + P Y+T +GLL G+ + G ++V GS W R+ W F Sbjct 359 LHEVVKSPRYATVMGLLQEGRVQRMRG-----RKVAVQSGSAKQVW-TRMKEWFIGNF 410 >gi|83748770|ref|ZP_00945785.1| FtsA [Ralstonia solanacearum UW551] gi|83724591|gb|EAP71754.1| FtsA [Ralstonia solanacearum UW551] Length=410 Score = 347 bits (890), Expect = 5e-94, Method: Composition-based stats. Identities = 187/418 (44%), Positives = 271/418 (64%), Gaps = 17/418 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KV A+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVVAVVAELRPDGAYEVIGMGQTESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS V+ ++G HI N GMV I ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKISEVFTGIAGSHIRSFNSSGMVAIKDKEVTPADVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLTEDE+ELGV +VDIG GT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLSVLTEDEKELGVVLVDIGSGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G + DE ++VP VG R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKIQYGIGKQVLADPDEMIDVPGVGDRGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ + R+ G + L++G+VLTGG A + G+ + +F VR+G P Sbjct 306 LVHQVV-------RESGYEELLSSGVVLTGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS----WIKRLNSWLRKEF 420 L + + P Y+T +GLL G+ + G ++V GS W R+ W F Sbjct 359 LHEVVKSPRYATVMGLLQEGRVQRMRG-----RKVAVQSGSAKQVW-TRMKEWFIGNF 410 >gi|72120072|gb|AAZ62335.1| Gene info Cell division protein FtsA [Ralstonia eutropha JMP134] gi|73542659|ref|YP_297179.1| Gene info Cell division protein FtsA [Ralstonia eutropha JMP134] Length=410 Score = 347 bits (889), Expect = 6e-94, Method: Composition-based stats. Identities = 187/414 (45%), Positives = 273/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KVAA+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVAAVVAELRPDGSYEVIGMGQSESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ V+ ++G HI N GMV I ++EVTQ DV V+ TAK+V + + + Sbjct 66 EAELMADCKIAEVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV++G A +I ++ +EVP VG R R+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVQYGIAKQAIADPEDMIEVPGVGDRGTRTLSRQALAAVIEPRIEELYS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ + R+ G + L++G+V+TGG A + G+ + +F VR+G P Sbjct 306 LVHQVV-------RESGYEELLSSGVVITGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P YST +GLL G+ + G + + SV R+ W F Sbjct 359 LHEVVKSPRYSTVMGLLLEGRVQRMRGRKVAVQ--SGSVKQVWGRMKEWFVGNF 410 >gi|68559742|ref|ZP_00599073.1| Cell division protein FtsA [Ralstonia metallidurans CH34] gi|68525904|gb|EAN48879.1| Cell division protein FtsA [Ralstonia metallidurans CH34] Length=410 Score = 346 bits (888), Expect = 9e-94, Method: Composition-based stats. Identities = 187/414 (45%), Positives = 272/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KVAA+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVGLDIGTSKVAAVVAELRPDGSYEVIGMGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ V+ ++G HI N GMV I ++EVTQ DV V+ TAK+V + + + Sbjct 66 EAELMADCKIAEVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G A +I ++ +EVP VG R R+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKMQYGIAKQAIADPEDMIEVPGVGDRGTRTLSRQALAAVIEPRIEELYS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ + R+ G + L++G+V+TGG A + G+ + +F VR+G P Sbjct 306 LVHQVV-------RESGYEELLSSGVVITGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P YST +GLL G + G + + SV R+ W F Sbjct 359 LHEVVKSPRYSTVMGLLQEGCVQRMRGRKVAVQ--SGSVKQVWGRMKEWFVGNF 410 >gi|77545874|gb|ABA89436.1| Gene info cell division protein FtsA [Pelobacter carbinolicus DSM 2380] gi|77919791|ref|YP_357606.1| Gene info cell division protein FtsA [Pelobacter carbinolicus DSM 2380] Length=409 Score = 345 bits (884), Expect = 2e-93, Method: Composition-based stats. Identities = 175/378 (46%), Positives = 260/378 (68%), Gaps = 8/378 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT K+ A+VG DG+ +I+G+G+ PSRG+ KG V ++ES V+ +++A+ +A Sbjct 8 LIVGLDIGTTKICAIVGHQNEDGL-DIVGIGTSPSRGLRKGVVINIESTVEAIRKALTEA 66 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMADC+I SVY ++G HI N G++ I EV +D+ V+ AK++ + + V+ Sbjct 67 ELMADCKIDSVYAGIAGGHIRGFNSQGVIAIKTREVLHDDIRRVLDAAKAIAIPMDREVI 126 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H +PQEY ID Q+GI +P+G+ GVR++AKVH++T A+NIV++ + ++V ++ Sbjct 127 HTLPQEYIIDDQDGILDPLGMCGVRLEAKVHIVTAATASAQNIVRSCYKADVEVSDIVLE 186 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VL+ DE++LGV +VDIGGGT DIA++ GA++HT V+ GN +T+DIA Sbjct 187 QLASSEAVLSTDEKDLGVALVDIGGGTTDIAIFIDGAIKHTSVLSLGGNHLTNDIAVGLR 246 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP ++AE IK ++GCA+ S+VGKDE++EVPSVGGR PR L R LAE++EPR E+ LV Sbjct 247 TPMAEAEVIKQKYGCAMTSMVGKDETIEVPSVGGREPRVLSRHLLAEILEPRVEEIFTLV 306 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 EI+ + G + LA+GIVLTGG+ + G+ A+++F+ VR G P I GLT Sbjct 307 QREII-------KSGFEDLLASGIVLTGGSCILPGMPEMAEQIFNLPVRRGLPQGIGGLT 359 Query 369 DYAQEPYYSTAVGLLHYG 386 D P Y+T VGL+ +G Sbjct 360 DVVNSPIYATGVGLVKFG 377 >gi|46450324|gb|AAS96972.1| Gene info cell division protein FtsA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] gi|46580904|ref|YP_011712.1| Gene info cell division protein FtsA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] Length=408 Score = 345 bits (884), Expect = 3e-93, Method: Composition-based stats. Identities = 182/412 (44%), Positives = 272/412 (66%), Gaps = 13/412 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT K+ A+VGE DG V+I+G+G+ PS G+ KG V ++E V+ +++A+++A Sbjct 6 LIVGLDIGTTKICAVVGEATADG-VDIVGIGTSPSTGLRKGVVVNIEQTVQSIKKALEEA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C+I SVY ++G HI N G++ + EV +D+E + AK+V + + V+ Sbjct 65 ELMAGCEIRSVYAGIAGSHIKGFNSHGVIAVKGGEVGPKDIERALDAAKAVAIPLDREVI 124 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQEY +D Q GI +P+G++GVR++ KVH++T A+NIV++ R GL V ++ Sbjct 125 HILPQEYVVDDQRGIADPLGMAGVRLEVKVHIVTGAVTSAQNIVRSCHRSGLDVSDIVLE 184 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VLTE+ERE+GV +VD+GGGT DIAV+ +++HT V+ G +T+DIA+ Sbjct 185 ALASSKAVLTEEEREIGVALVDLGGGTTDIAVFANDSIKHTGVLALGGQNLTNDIAFGLR 244 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IKV++GCA+ +V DE +EVPSVGGR PR L RQ LAE+ EPR E+L+LV Sbjct 245 TPMISAEKIKVKYGCAMAEMVRNDELIEVPSVGGREPRRLSRQVLAEICEPRMEEILSLV 304 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 ++E++ + G K+ + +G+VLTGG A IEG +++F+ RIG P N+ GL Sbjct 305 DQELV-------RSGFKNQIGSGVVLTGGTALIEGCQELGEQIFNMPTRIGYPRNVGGLK 357 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 D P ++TAVGLL YG E + +E + G+ R+ S +RK F Sbjct 358 DVVNSPKFATAVGLLRYGAE-----KEGLELKFRIRDGNVFNRVLSRMRKWF 404 >gi|74024661|ref|ZP_00695194.1| Cell division protein FtsA [Rhodoferax ferrireducens DSM 15236] gi|72602629|gb|EAO38668.1| Cell division protein FtsA [Rhodoferax ferrireducens DSM 15236] Length=409 Score = 342 bits (876), Expect = 2e-92, Method: Composition-based stats. Identities = 189/414 (45%), Positives = 267/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV +V EVLP+G + + G+G PS G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTAKVMVVVAEVLPNGALKLAGLGVAPSNGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ VY ++G HI N GMV I + EV+ DV VV TAK++ + + R Sbjct 66 EAELMADCKITRVYTGITGSHIRGINSHGMVAIKDREVSAADVARVVETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ +K PVG+SG+R++AKVH++T A+NI+K V RCGL+V+QL+ Sbjct 126 LLLVEPQEFIIDGQD-VKEPVGMSGIRLEAKVHIVTGAQSAAENIIKCVRRCGLEVEQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLTEDERELGV +VDIG GT DIA++T GA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSLSVLTEDERELGVALVDIGAGTTDIAIFTNGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV G A + + VEVP +G R PR L RQ LA VIEPR E+ + Sbjct 245 LRTPTKDAEEIKVESGYAKQLLADPEAQVEVPGLGDRGPRMLSRQALAGVIEPRVEEIFS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV+ + +R+ G + L++GIVLTGG+ + G+ + +F VR G P + Sbjct 305 LVH-------QVMRESGFEEMLSSGIVLTGGSCVMPGMVELGEDIFLKPVRRGIPKYSSA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D +P +T +GLL + + L G +K S+ + ++ W F Sbjct 358 LADMVAQPRAATVMGLLEEARMARLRGFKVAQK--NGSMKNAFGQVKDWFVGNF 409 >gi|86160195|ref|YP_466980.1| Gene info cell division protein FtsA [Anaeromyxobacter dehalogenans 2CP-C] gi|85776706|gb|ABC83543.1| Gene info cell division protein FtsA [Anaeromyxobacter dehalogenans 2CP-C] Length=410 Score = 338 bits (867), Expect = 3e-91, Method: Composition-based stats. Identities = 187/421 (44%), Positives = 279/421 (66%), Gaps = 12/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K+ D ++VGL+IGT K+ A+VGEV DG ++IIG+GS PS+G+ KG V ++++ V Sbjct 1 MAKSGD--ILVGLDIGTTKICAIVGEVTDDGSIDIIGIGSHPSKGLRKGVVVNIDATVAS 58 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++RAI++AE MA C+I++VY ++G HI G+V + ++EV Q+DV+ V+ AK+V Sbjct 59 IKRAIEEAEHMAGCEITTVYTGIAGGHIKAFPSHGVVAVKDKEVRQQDVDRVIDQAKAVA 118 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + V+HV+PQE+ +D Q+G+K PVG+SGVR++AK ++T A+NIVK +R GL Sbjct 119 IPLDREVIHVLPQEFVVDDQDGVKEPVGMSGVRLEAKALIVTGAVSSAQNIVKCAQRTGL 178 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V ++ LASS + L+EDE+ELGVC+VD+GGGT DIA++ G+++HT VI GN +T Sbjct 179 NVADIVLQPLASSLATLSEDEKELGVCLVDVGGGTTDIAIFHNGSIQHTAVISLGGNHLT 238 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +D+A TP +AE IK ++GCA+ S+V K E++EVPSVGG PR L R LAE++EPR Sbjct 239 NDVAVGLRTPTHEAERIKKQYGCAMASMVDKTETIEVPSVGGGQPRVLSRHILAEIVEPR 298 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+ LV EI ++ G++ LA+G+V+TGG+ + G+ A+ V VR G Sbjct 299 VEEIFMLVQHEI-------QKCGMEEILASGVVITGGSTLLAGMPEMAEEVLGVPVRRGM 351 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIK-RLNSWLRKE 419 P I GL D + P Y+TAVGL+ YG +H E+ K +V +K R+ WL + Sbjct 352 PRGIGGLVDVVKSPMYATAVGLVIYG--AHQQDESPYFKIRDENVYRKVKVRMKEWLGQI 409 Query 420 F 420 F Sbjct 410 F 410 >gi|78218498|gb|ABB37847.1| Gene info cell division protein FtsA [Desulfovibrio desulfuricans G20] gi|78356093|ref|YP_387542.1| Gene info cell division protein FtsA [Desulfovibrio desulfuricans G20] Length=408 Score = 338 bits (866), Expect = 3e-91, Method: Composition-based stats. Identities = 178/412 (43%), Positives = 270/412 (65%), Gaps = 13/412 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT K+ +VGE +G ++I+G+G+ PS G+ KG V ++E V+ +++A+++A Sbjct 6 LIVGLDIGTTKICCVVGEPTEEG-IDIVGIGTSPSTGLRKGVVVNIEQTVQSIKKALEEA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C+I SVY ++G HI N G++ + EV DVE V+ AK++ + + V+ Sbjct 65 ELMAGCEIRSVYAGIAGSHIKGANSDGVIAVKGGEVAPRDVERVLDAAKALNIPMDREVI 124 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQEY +D Q GI +P+G++GVR++ KVH++T A+NIV++ R GL V ++ Sbjct 125 HILPQEYIVDEQRGIADPLGMAGVRLEVKVHIVTGAVASAQNIVRSCHRSGLDVSDIVLE 184 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VLTE+ERE+GV +VD+GGGT DIAV+ +++HT V+ G +T+DIA+ Sbjct 185 ALASSKAVLTEEEREIGVALVDLGGGTTDIAVFANDSIKHTGVLALGGQNLTNDIAFGLR 244 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP + AE IK+++GCA+ +V DE +EV SVG R PR L RQ LAE+ EPR E+L+LV Sbjct 245 TPMASAEKIKIKYGCAMAEMVRDDEGIEVASVGDREPRRLSRQVLAEICEPRMEEILSLV 304 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 ++E+++ G K+ + AG+VLTGG A IEG +++F+ RIG P N+ GL Sbjct 305 DQELVRY-------GFKNMIGAGVVLTGGTALIEGCQELGEQIFNLPTRIGYPRNVGGLK 357 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 D P ++TAVGLL YG E + +E + G+ R+ S +RK F Sbjct 358 DVVNSPKFATAVGLLCYGAE-----KEGLELKFRIRDGNMFNRVLSRMRKWF 404 >gi|67848311|ref|ZP_00503429.1| Cell division protein FtsA [Polaromonas sp. JS666] gi|67781358|gb|EAM40972.1| Cell division protein FtsA [Polaromonas sp. JS666] Length=409 Score = 337 bits (863), Expect = 8e-91, Method: Composition-based stats. Identities = 185/414 (44%), Positives = 270/414 (65%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGT+KV A+V EV+P G + + G+G S G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTSKVMAVVAEVMPGGELKLAGLGIAASNGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS VY ++G HI N GMV + ++EVTQ DV V+ TAK++ + + R Sbjct 66 EAELMADCKISRVYTGITGSHIRGINSSGMVAVKDKEVTQADVARVIETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ ++ P+G+SG+R++AKVH++T A+NI+K V RCGL+VDQL+ Sbjct 126 LLLVEPQEFVIDGQD-VREPIGMSGIRLEAKVHIVTGAQSAAENIIKCVRRCGLEVDQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLT+DE+ELGV +VDIG GT D+A++TGGA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSLAVLTQDEQELGVALVDIGAGTTDVAIFTGGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV G A + D VEVP +G R PR L +Q LA VIEPR E+ + Sbjct 245 LRTPTKDAEDIKVESGYAKQLLADPDTQVEVPGLGDRGPRMLSKQALAGVIEPRIEEIYS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++GIV+TGG+A + G+ + +F VR G P + Sbjct 305 LV-------QQVIRESGYEEVLSSGIVITGGSAVMPGMVELGEDIFLKPVRRGIPRYSSA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + +T +GLL + + + G +K SV + R+ W F Sbjct 358 LSDMVAQARAATVMGLLEEARLARMRGYKVAQK--AGSVHNAFGRVKDWFVGNF 409 >gi|68177554|ref|ZP_00550701.1| Cell division protein FtsA [Desulfuromonas acetoxidans DSM 684] gi|67982376|gb|EAM71783.1| Cell division protein FtsA [Desulfuromonas acetoxidans DSM 684] Length=409 Score = 335 bits (860), Expect = 2e-90, Method: Composition-based stats. Identities = 179/413 (43%), Positives = 275/413 (66%), Gaps = 12/413 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT K+ A++ + G+ +I+G+G+ SRG+ KG V ++ES V+ +++A+ +A Sbjct 8 LIVGLDIGTTKICAIIASMTDSGL-DIVGIGTSVSRGLRKGVVINIESTVEAIKKALQEA 66 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C+I+SV+ ++G HI+ N G++ I EVT EDV+ V+ AK++ + + V+ Sbjct 67 ELMAGCEINSVFAGIAGAHITGFNSQGVIAIKNREVTSEDVQRVIDAAKAIAIPMDREVI 126 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HVIPQE+ ID Q+GIK P+G+SGVR+++KVH++T A+NIVK+ + + V ++ Sbjct 127 HVIPQEFIIDDQDGIKEPLGMSGVRLESKVHIVTGAVASAQNIVKSCNKASVNVADIVLE 186 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VL+ DE+ELGV +VDIGGGT D+A++ GA++HT V+ GN +T+DIA Sbjct 187 PLASSEAVLSADEKELGVAIVDIGGGTTDLAIFVDGAIKHTAVLSLGGNHLTNDIAVGLR 246 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP ++AE IK +G L S +GKDE++EVPSVGGR PR L RQ LAE++EPR E+ LV Sbjct 247 TPMAEAERIKHAYGSCLTSDIGKDETIEVPSVGGREPRILSRQLLAEILEPRVEEIFTLV 306 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 N EI+ + G + +A+G+V+TGG + + G+ A+++F+ VR G P I GL Sbjct 307 NREIV-------RSGFEDLIASGVVITGGTSILPGMPELAEQIFNLPVRRGVPQGIGGLI 359 Query 369 DYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 D P Y+T VGL+ YG K +N + +++V V ++R+ W + F Sbjct 360 DVVNSPIYATGVGLVIYGSKNQEINNFSIGQEKVFDKV---MRRMKEWFGEFF 409 >gi|84715213|ref|ZP_01022368.1| Cell division protein FtsA [Polaromonas naphthalenivorans CJ2] gi|84693336|gb|EAQ19137.1| Cell division protein FtsA [Polaromonas naphthalenivorans CJ2] Length=409 Score = 335 bits (859), Expect = 2e-90, Method: Composition-based stats. Identities = 183/414 (44%), Positives = 268/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGT+K+ +V EV+P G + + G+G S+G+ +G V ++++ V +Q+A+ Sbjct 6 KDLVVGLDIGTSKIMVVVAEVMPGGQLKLAGLGIAASQGLKRGVVVNIDATVHSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I V+ ++G HI N GMV + ++EVTQ DV V+ TAK++ + + R Sbjct 66 EAELMADCKIGRVFTGITGSHIRGINSSGMVAVKDKEVTQADVTRVIETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ ++ P+G+SG+R++AKVH++T A+NI+K V RCGL+VDQL+ Sbjct 126 LLLVEPQEFVIDGQD-VREPIGMSGLRLEAKVHIVTGAQSAAENIIKCVRRCGLEVDQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLT+DE+ELGV +VDIG GT D+A++TGGA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSQSVLTQDEQELGVAMVDIGAGTTDVAIFTGGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +GCA + D VEVP +G R PR L +Q LA VIEPR E+ Sbjct 245 LRTPTKDAEDIKVENGCAKQLLADPDTQVEVPGLGDRGPRMLSKQALAGVIEPRVEEIYL 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++GIV+TGG+A + G+ + +F VR G P Sbjct 305 LV-------QQVIRESGYEEVLSSGIVITGGSAMMPGMIELGEDIFLKPVRRGLPRYSGA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + +T +GLL + + + G +K S+ S R+ W F Sbjct 358 LSDMVAQTRAATVMGLLEEARLARIRGFKVSQK--AGSMHSAFGRVKDWFVGNF 409 >gi|47574472|ref|ZP_00244508.1| COG0849: Actin-like ATPase involved in cell division [Rubrivivax gelatinosus PM1] Length=409 Score = 334 bits (857), Expect = 4e-90, Method: Composition-based stats. Identities = 181/414 (43%), Positives = 267/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV A+V EVLP+G + + G+G+ P+ G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTAKVMAVVAEVLPEGELRVAGIGTAPAHGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AE+MADC+I+ VY ++G HI QN GMV + ++EVT DV V+ TAK++ + ++ R Sbjct 66 EAEMMADCKITRVYTGITGSHIRGQNSTGMVIVRDKEVTPVDVARVIETAKAINIPNDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V QE+ ID E +K P+G+SG R++ KVH++T A+NI+K V RCGL+VD L+ Sbjct 126 MLLVEAQEFVIDGHE-VKEPIGMSGGRLEVKVHIVTGAQSAAENIIKCVRRCGLEVDMLV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 ASS++VLT+DE++LGV +VDIG GT D++++T G++RHT VIP AG+++TSDIA A Sbjct 185 LNPSASSHAVLTDDEKDLGVALVDIGAGTTDVSIFTDGSVRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV HG A + +E VEVP +G R PR L RQ LA VIEPR E+ + Sbjct 245 LRTPTKDAEEIKVEHGVAKQLLADPNEQVEVPGLGDRGPRMLSRQALAGVIEPRVEEIFS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ I R+ G + L++GIVLTGG A + G+ + +F VR G P Sbjct 305 LVHQVI-------RESGYEELLSSGIVLTGGTAVMPGMVELGEDIFLKPVRKGLPTYAGA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D P +T +GLL + + G ++ SV + R+ W F Sbjct 358 LSDMVASPRSATVMGLLEEARLARTRGMKAAQQ--AGSVQTLFGRVKDWFIGNF 409 >gi|71548015|ref|ZP_00668508.1| Cell division protein FtsA [Syntrophobacter fumaroxidans MPOB] gi|71486461|gb|EAO18965.1| Cell division protein FtsA [Syntrophobacter fumaroxidans MPOB] Length=406 Score = 331 bits (848), Expect = 4e-89, Method: Composition-based stats. Identities = 184/408 (45%), Positives = 265/408 (64%), Gaps = 11/408 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 +L+VGL++GT KV A+VGEV +GM +I+GVG+ PS G+ G V +++ V +++A+++ Sbjct 6 ELIVGLDLGTTKVCAVVGEVTSEGM-DIVGVGTYPSIGLRGGVVVNIDQTVHSIRKAVEE 64 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRV 127 AELMA C+ISSVY ++G H+ N G++ I EVTQ D++ V+ AK+V + + ++ Sbjct 65 AELMAGCEISSVYAGVAGTHVQSLNSHGVIAIKSREVTQADIDRVLDAAKTVALPFDRQI 124 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 LHV+PQ+Y +D QEGI+NP G++GVR++AKVH+IT +NIVK ER GL+V ++ Sbjct 125 LHVLPQQYIVDDQEGIQNPTGMAGVRLEAKVHIITGAIAAVQNIVKCCERAGLQVQDVVL 184 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 LASS SVL DER LGV +VD+GGGT DIAV+ A+R++ V+ GN +TSDI+ Sbjct 185 ESLASSESVLDMDERHLGVALVDLGGGTSDIAVFMDHAIRYSCVVGLGGNHITSDISVGL 244 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNL 307 T +AE IK +HGCAL V + + +EV SVGG+ PR L R LA+++E R E++ + Sbjct 245 RTSIDEAEKIKKKHGCALVEWVNQQDMIEVGSVGGQKPRQLARSVLAQIVEARVEEIVKI 304 Query 308 VNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGL 367 + E++ + G L AG+VLTGG + + G+ A++VF VRIG P N GL Sbjct 305 IEWELV-------RSGYVESLHAGVVLTGGVSLLPGIRELAEKVFDLPVRIGVPYNFGGL 357 Query 368 TDYAQEPYYSTAVGLLHYGKESHLNG---EAEVEKRVTASVGSWIKRL 412 D + P Y+TA GLL YGK+ G E V K+V ASV W K Sbjct 358 GDVVKNPIYATATGLLLYGKKHGNRGPMEEPSVIKKVLASVRRWFKEF 405 >gi|85858530|ref|YP_460732.1| Gene info cell division protein [Syntrophus aciditrophicus SB] gi|85721621|gb|ABC76564.1| Gene info cell division protein [Syntrophus aciditrophicus SB] Length=409 Score = 325 bits (832), Expect = 3e-87, Method: Composition-based stats. Identities = 174/381 (45%), Positives = 260/381 (68%), Gaps = 8/381 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL+IGT K A+VGEV G ++IIG+GS PS G+ KG V +++S V+ ++ A+++A Sbjct 7 VIVGLDIGTTKTCAIVGEVTDTG-IDIIGIGSHPSDGLRKGVVVNIDSTVEAIKAAVEEA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 E M+ C+I SV+ ++G HI QN +G+V + EV EDVE + AK++ + + ++L Sbjct 66 ERMSGCEIGSVFTGIAGGHIKAQNSLGIVAVKGREVGSEDVERAIEAAKAIAIPLDRQIL 125 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H +PQ Y +D Q+GIK+PVG+SGVR++AKVH++T +NI K+V R GL ++ ++ Sbjct 126 HTLPQSYVVDEQDGIKDPVGMSGVRLEAKVHVVTGVVTSIQNIEKSVTRVGLDINDIVLE 185 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LA+S +VL++DER+LGV ++DIGGGT +IAV+ G++RHT VIP GN VTSDIA Sbjct 186 QLAASQAVLSDDERDLGVALLDIGGGTTNIAVFWEGSIRHTAVIPVGGNYVTSDIATGLR 245 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP ++AE IK+ GCA ++ K+E++EVPSVGGR PR + RQ L +IE R E+LN+ Sbjct 246 TPLNEAEKIKIGFGCAYAPMIPKEETIEVPSVGGREPRVVSRQILGRIIEARMEEILNMA 305 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +EI+ + G + LAAG+VL GG A ++G+ +++F+ VR G P I GLT Sbjct 306 YKEIV-------RSGYEDVLAAGVVLAGGTALLDGITELTEQIFNMPVRRGYPSGIGGLT 358 Query 369 DYAQEPYYSTAVGLLHYGKES 389 D P Y+T VGL+ YG ++ Sbjct 359 DVVNSPMYATGVGLVLYGSKN 379 >gi|75821356|ref|ZP_00751283.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae RC385] Length=222 Score = 323 bits (829), Expect = 7e-87, Method: Composition-based stats. Identities = 152/222 (68%), Positives = 187/222 (84%), Gaps = 0/222 (0%) Query 199 EDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIK 258 EDERELGVCVVDIG GTMDIA++TGGALRHT+V YAGN VTSDIA+AFGTP SDAE IK Sbjct 1 EDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVTSDIAFAFGTPVSDAEEIK 60 Query 259 VRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEK 318 V++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPRYTEL+ LVN+ + +QE Sbjct 61 VKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPRYTELMGLVNQTVDSVQES 120 Query 319 LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYST 378 LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF QVR+G PL ++GLTDY +EPY+ST Sbjct 121 LRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGKPLEVSGLTDYVKEPYHST 180 Query 379 AVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 AVGLLHY ++S ++ + E ++ S+ WI RL +W++KEF Sbjct 181 AVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 222 >gi|7380686|emb|CAB85276.1| Gene info cell division protein [Neisseria meningitidis Z2491] gi|15794936|ref|NP_284758.1| Gene info cell division protein [Neisseria meningitidis Z2491] Length=414 Score = 320 bits (819), Expect = 9e-86, Method: Composition-based stats. Identities = 175/414 (42%), Positives = 256/414 (61%), Gaps = 16/414 (3%) Query 13 LEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMA 72 L+IGT+KV AL+GEV D +NI+G+G PSRG+ G V ++++ V+ +++A++ AELMA Sbjct 11 LDIGTSKVLALIGEVQDDDKINIVGLGQAPSRGLRAGMVTNIDATVQAIRQAVNDAELMA 70 Query 73 DCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIP 132 D +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + ++L + Sbjct 71 DTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPDQKILDAVV 130 Query 133 QEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLAS 192 Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +ERCGLK DQ++ LAS Sbjct 131 QDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIERCGLKSDQIMLQPLAS 190 Query 193 SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPS 252 +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ + TP Sbjct 191 GQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLSKSLRTPLD 250 Query 253 DAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEI 312 AE IK+ +G A G E +EVP VG R R + + LA +I R E+ +V E Sbjct 251 AAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEIFGVVLGE- 309 Query 313 LQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYA 371 L++ G K L AGIVLTGG + + G+ A+++F VR GAP + GL+D Sbjct 310 ------LQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQEMGGLSDRV 363 Query 372 QEPYYSTAVGLLHY-----GKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + P +STA+GLLH G L A E+ G + RL W+ F Sbjct 364 RTPRFSTAIGLLHAACKLEGNLPQLENGAVQERE---GGGGLLARLKRWIENSF 414 >gi|7225649|gb|AAF40864.1| Gene info cell division protein FtsA [Neisseria meningitidis MC58] gi|15676338|ref|NP_273474.1| Gene info cell division protein FtsA [Neisseria meningitidis MC58] Length=414 Score = 319 bits (817), Expect = 2e-85, Method: Composition-based stats. Identities = 173/411 (42%), Positives = 255/411 (62%), Gaps = 10/411 (2%) Query 13 LEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMA 72 L+IGT+KV AL+GEV D +NI+G+G PSRG+ G V ++++ V+ +++A++ AELMA Sbjct 11 LDIGTSKVLALIGEVQDDDKINIVGLGQAPSRGLRAGMVTNIDATVQAIRQAVNDAELMA 70 Query 73 DCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIP 132 D +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + ++L + Sbjct 71 DTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPDQKILDAVV 130 Query 133 QEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLAS 192 Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +ERCGLK DQ++ LAS Sbjct 131 QDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIERCGLKSDQIMLQPLAS 190 Query 193 SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPS 252 +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ + TP Sbjct 191 GQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLSKSLRTPLD 250 Query 253 DAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEI 312 AE IK+ +G A G E +EVP VG R R + + LA +I R E+ +V E Sbjct 251 AAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEIFGVVLGE- 309 Query 313 LQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYA 371 L++ G K L AGIVLTGG + + G+ A+++F VR GAP + GL+D Sbjct 310 ------LQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQEMGGLSDRV 363 Query 372 QEPYYSTAVGLLHYG--KESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + P +STA+GLLH E +L + G + RL W+ F Sbjct 364 RTPRFSTAIGLLHAACKLEGNLPQPENGAVQEREGGGGLLARLKRWIENSF 414 >gi|59801865|ref|YP_208577.1| Gene info FtsA [Neisseria gonorrhoeae FA 1090] gi|59718760|gb|AAW90165.1| Gene info putative cell division protein [Neisseria gonorrhoeae FA 1090] Length=414 Score = 316 bits (809), Expect = 1e-84, Method: Composition-based stats. Identities = 166/379 (43%), Positives = 246/379 (64%), Gaps = 8/379 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ + L+IGT+KV AL+GEV D +NIIG+G PSRG+ G V ++++ V+ +++A++ Sbjct 5 KRYISVLDIGTSKVLALIGEVQDDDKINIIGLGQAPSRGLRAGMVTNIDATVQAIRQAVN 64 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 AELMAD +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + + Sbjct 65 DAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPDQK 124 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L + Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +E CGLK DQ++ Sbjct 125 ILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIELCGLKSDQIM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ + Sbjct 185 LQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLSKS 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP AE IK+ +G A G E +EVP VG R R + + LA +I R E+ Sbjct 245 LRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEIFG 304 Query 307 LVNEEILQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V E L++ G K L AGIVLTGG + + G+ A+++F VR GAP + Sbjct 305 VVLGE-------LQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQEMG 357 Query 366 GLTDYAQEPYYSTAVGLLH 384 GL+D + P +STA+GLLH Sbjct 358 GLSDRVRTPRFSTAIGLLH 376 >gi|39576781|emb|CAE80945.1| Gene info cell division protein FtsA [Bdellovibrio bacteriovorus HD100] gi|42524572|ref|NP_969952.1| Gene info cell division protein FtsA [Bdellovibrio bacteriovorus HD100] Length=418 Score = 300 bits (768), Expect = 8e-80, Method: Composition-based stats. Identities = 157/378 (41%), Positives = 241/378 (63%), Gaps = 7/378 (1%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++ GL+IG+ KV+ ++G V P+G + + GVG+ P+ G+ +G V ++E+ +++A ++A Sbjct 10 VLAGLDIGSTKVSFVIGTVNPEGKIEVAGVGTAPNTGIRQGVVVNIEATTDSIRKAKEEA 69 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELM+ +S V++ ++G HIS + GMV I EVT +++ V+ AK+V V + VL Sbjct 70 ELMSGYTVSEVWVGVAGSHISSFDSKGMVAIKNREVTASEIDRVIEAAKAVAVPTDRSVL 129 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+P+E+ +D Q+GI +P+G+SG+R++A VH++T N VK VE+ GLK+ L+ + Sbjct 130 HVLPREFKVDGQDGITDPIGMSGIRLEANVHIVTGGQSAINNTVKCVEKAGLKIAGLVLS 189 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LAS+ +V++ DE+ LGVCVVD+GGG + + G++ H+ VIP G T D+A Sbjct 190 QLASATAVMSNDEKNLGVCVVDMGGGACNALYFVNGSVAHSSVIPVGGQHFTHDVAVGLR 249 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE +K +HGCA+ S+V ++E+VEV VGGR R + R+ LA+VIE R E LNL+ Sbjct 250 TPQFAAEELKKKHGCAMASMVNENETVEVEGVGGRKSRVIPRKDLADVIEARAEETLNLI 309 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +I R G+ L GIVLTGGA+ ++GL + +F VR GAP I GLT Sbjct 310 ANDI-------RMSGLMPMLGGGIVLTGGASNLDGLIEMGEFIFDIPVRRGAPREIGGLT 362 Query 369 DYAQEPYYSTAVGLLHYG 386 D + +S AVGLL Y Sbjct 363 DVVKSGEFSAAVGLLQYA 380 >gi|83572614|gb|ABC19166.1| Gene info cell division protein FtsA [Moorella thermoacetica ATCC 39073] gi|83589700|ref|YP_429709.1| Gene info cell division protein FtsA [Moorella thermoacetica ATCC 39073] Length=410 Score = 300 bits (767), Expect = 1e-79, Method: Composition-based stats. Identities = 170/414 (41%), Positives = 251/414 (60%), Gaps = 11/414 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +V G++IGT KV A+V EV+P+G +NIIG+G PS G+ KG + D+E+ + + AI+QA Sbjct 6 IVAGIDIGTTKVVAVVAEVMPEGRLNIIGLGETPSGGLRKGIIVDIENTSRAIAGAIEQA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHR 126 E M+ CQ+ S ++ L+G HI N G+V ++ E E++ EDVE V+ A+ + + E R Sbjct 66 ERMSGCQVHSAFVGLTGPHIDSLNNRGVVAVTGEDGEISLEDVERVLQAARVIPLAAERR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++HV+P++Y +D +G+ +PVG+ G R++ + ++T +NI+K+V+R GL VD+L+ Sbjct 126 IIHVLPRQYIVDGYDGVMDPVGMCGSRLEVETQIVTAAGAAVQNIMKSVQRAGLAVDELV 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS+ +VL + ERELG VVDIGGGT +IA+ + G+L V+P +TSD+A Sbjct 186 LNPLASAGAVLQQAERELGSVVVDIGGGTTEIALISQGSLWFASVLPIGSEHITSDLAVG 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP AE IK +GC V +E+VEVP VGGR R + R+ LA +IEPR E+ Sbjct 246 LRTPIVQAEVIKKEYGCVPADAVPDNEAVEVPPVGGREKRRVSRKALAAIIEPRVEEIFT 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV E+ QG+ L G+VLTGG A +EG+ A + VR+G P +G Sbjct 306 LVRREL----SSAHFQGL---LPGGVVLTGGGALLEGITGMAAEILAMPVRLGWPEGGSG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D P Y+TAVGL++YG + +A R T W RL SW R+ F Sbjct 359 LADMVAAPPYATAVGLVNYGARRLAHPQA-AATRETGWENFW-SRLKSWWRELF 410 >gi|75822196|ref|ZP_00751871.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae RC385] Length=203 Score = 294 bits (753), Expect = 4e-78, Method: Composition-based stats. Identities = 142/203 (69%), Positives = 179/203 (88%), Gaps = 0/203 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLITCHNDMA+NI+KAVERCGL Sbjct 121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERE 203 KV+QL+++GLA+S +V+TEDERE Sbjct 181 KVEQLVYSGLAASNAVITEDERE 203 >gi|89210851|ref|ZP_01189235.1| Cell division protein FtsA [Halothermothrix orenii H 168] gi|89159592|gb|EAR79256.1| Cell division protein FtsA [Halothermothrix orenii H 168] Length=390 Score = 282 bits (721), Expect = 2e-74, Method: Composition-based stats. Identities = 160/394 (40%), Positives = 240/394 (60%), Gaps = 21/394 (5%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R+++ GL+IGT K+ A++ EV + ++IIG+G PS G+ KG V D++ +++A++ Sbjct 4 RRIITGLDIGTTKICAMIAEVNSEDKLDIIGIGLSPSHGLRKGIVVDIDKTSNAIKQAVE 63 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 +AE MA QI S ++ ++G HIS N G+V +S E+E+ D++ V+ AK + + E Sbjct 64 KAERMAGRQIDSAFVGIAGSHISSLNSHGVVAVSGEEKEIKPSDIQRVMEAAKIIPLSAE 123 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++HV+ +E+ +D GIK+P+G+SGVR++ + H++T +N+VK+V R GL VD Sbjct 124 EEIIHVLAREFIVDGCPGIKDPLGMSGVRLEVETHIVTGSTTSIQNLVKSVLRAGLDVDD 183 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASS SVLTEDE+ELGV +VD+GGGT D+ V+ G++ +T V+P GN V++DIA Sbjct 184 IVLEPLASSESVLTEDEKELGVALVDVGGGTTDLIVFQEGSITYTSVLPVGGNHVSNDIA 243 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 TP ++AE IK+ G A +G DE +EV S + + R+ L EVIEPR E+ Sbjct 244 VGLRTPIAEAEKIKIMAGSATTKNIGDDEYIEVVSASRKKKNKIPRKALCEVIEPRMQEI 303 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 NLV E L + G + AG+VLTGGA+ +EG A V VR+G P + Sbjct 304 FNLVKRE-------LDEVGPRDLTPAGVVLTGGASLLEGAEELASEVIGLPVRLGEPDYV 356 Query 365 TGLTDYAQEPYY------------STAVGLLHYG 386 GLTD P Y STAVGL+ YG Sbjct 357 NGLTDVIDNPVYVKKGKQVPKAIFSTAVGLVEYG 390 >gi|50877783|emb|CAG37623.1| Gene info probable cell division protein FtsA [Desulfotalea psychrophila LSv54] gi|51246746|ref|YP_066630.1| Gene info cell division protein FtsA [Desulfotalea psychrophila LSv54] Length=447 Score = 278 bits (711), Expect = 3e-73, Method: Composition-based stats. Identities = 154/407 (37%), Positives = 251/407 (61%), Gaps = 11/407 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++V+GL+IGT K+ +VGE+L D + I+GVG+ PS G+ KG V ++ES V+ +Q+A+ Sbjct 49 EIVIGLDIGTTKICCVVGELLDDSLY-ILGVGTVPSSGLKKGVVYNIESTVQSIQKALRL 107 Query 68 AELMADCQISSV--YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 AE +D ++ +V Y+ ++G HI N G+V I++ E+ + D+E V A++V++ Sbjct 108 AEESSDYELKNVPAYVGIAGDHIKGFNSPGIVAINDREIKKSDLEAVRRAAQTVKISQNQ 167 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HV+PQEY +D GI+NPVG++GVR+ VH++T N+V E+ G+KV L Sbjct 168 NIIHVLPQEYMVDDNVGIQNPVGMTGVRLATNVHIVTADVGAIHNLVTCCEKAGVKVASL 227 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + +AS+++VLT +E+E GV +VDIGGGT D AV+ GG +R T I + G+ +T+DI+ Sbjct 228 VLESVASAHAVLTREEKENGVALVDIGGGTTDTAVFHGGTVRQTSQINFGGHNLTNDISV 287 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T DAE +K +G A+ S+V + VEVP G + P ++ L E++E R E+L Sbjct 288 GLLTSLGDAEWLKENYGGAIASVVKSNYVVEVPKRGDKNPVKTPQKFLVEILEARTKEIL 347 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V+E ++ + G K ++ GIVLTGG A + +A A+++F VR+G P +T Sbjct 348 EMVDEALI-------ESGQKTNIGHGIVLTGGTALLPNIADLAEQIFDLPVRVGYPEGLT 400 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRL 412 G + P +TAVGL+ +G+E H G+ V+ V + + K + Sbjct 401 GRVENVYTPRCTTAVGLVLFGREEH-QGKGLVDHSVFTKICRFFKNI 446 >gi|2688166|gb|AAC66648.1| Gene info cell division protein (ftsA) [Borrelia burgdorferi B31] gi|3023796|sp|Q44774|FTSA_BORBU Cell division protein ftsA gi|15594645|ref|NP_212434.1| Gene info cell division protein (ftsA) [Borrelia burgdorferi B31] gi|1165284|gb|AAA85623.1| FtsA Length=413 Score = 263 bits (671), Expect = 1e-68, Method: Composition-based stats. Identities = 148/417 (35%), Positives = 251/417 (60%), Gaps = 10/417 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + +I+ Sbjct 3 RNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNSIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDE 124 AEL++ C I+S+ +++SG + N G+V I+ + E+ +EDVE V+ AK++ + + Sbjct 63 AAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSKTREINEEDVERVIEAAKAIVIPMD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +LHVIPQE+ +D IKNP+ + G+R++ +VH+IT + ++N+V+ V R G VD+ Sbjct 123 REILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSSSSSQNLVRCVNRAGFAVDE 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT DIA Sbjct 183 VVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + P AE IK+ G A SI+ + E+V +P++G RPP+ R+ L+ +I R E Sbjct 243 QVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRLRE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P++ Sbjct 303 IFEMMKAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLPMS 355 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I G+ + +P +S+A+GL+ Y E + + +L W KE+ Sbjct 356 INGIGEEHIDPKFSSALGLVLYKHEQQKFNKLKKVSSKVKRKNKISSKLKGWFLKEW 412 >gi|83816584|ref|YP_444706.1| Gene info cell division protein FtsA [Salinibacter ruber DSM 13855] gi|83757978|gb|ABC46091.1| Gene info cell division protein FtsA [Salinibacter ruber DSM 13855] Length=425 Score = 262 bits (669), Expect = 2e-68, Method: Composition-based stats. Identities = 155/401 (38%), Positives = 238/401 (59%), Gaps = 8/401 (1%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 A + +VVG++IGT KV A+V VNI+GVG PS G+++G V +++ V V+ Sbjct 6 AMNENIVVGVDIGTTKVCAVVAGKDDLDRVNILGVGMAPSDGLNRGVVVNIDRTVAAVRE 65 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A+++AE A ++ +V + ++G H+ G+V I+ E+TQ DV+ ++ V + Sbjct 66 AVEEAERAAGVEVQNVVVGIAGDHVQSFQTRGVVTINANEITQNDVQRLLEDTTHVALPA 125 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + +LHVIPQE+ +D Q+G+ +PVG+SGVR++A VH+IT AKNI + +E+ G +V Sbjct 126 DREILHVIPQEFIVDGQDGVADPVGMSGVRLEADVHIITGLVSAAKNIYRCIEKAGFRVS 185 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 L+ LASS+SVL EDE+E+GV ++DIGGGT DIAV+ +RHT VI AG+ VT DI Sbjct 186 DLVLEPLASSFSVLHEDEKEVGVALIDIGGGTTDIAVFEDHTIRHTAVIAVAGDKVTDDI 245 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 G AE +K + G AL DE +E+P +GGR +++ R LA++I+PR E Sbjct 246 RKGLGVMRDQAEQLKRQFGVALAGEADSDEKIEIPGIGGRDEKTIGRDALAQIIQPRLEE 305 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L + EI ++ G HL G VLTGG + + A V + R+G P+ Sbjct 306 ILEIAAMEI-------KRSGYGRHLGVGAVLTGGGSLVPYTDELAAEVLGMEARVGRPMG 358 Query 364 IT-GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTA 403 ++ GL + +P +ST VGL+ YG + G + + V A Sbjct 359 LSGGLVEEVSDPKFSTGVGLVLYGMRPDIIGGTTLSEEVRA 399 >gi|1200208|emb|CAA78155.1| ftsA [Borrelia burgdorferi] gi|1234875|emb|CAA65463.1| ftsA [Borrelia burgdorferi] Length=413 Score = 261 bits (668), Expect = 3e-68, Method: Composition-based stats. Identities = 148/417 (35%), Positives = 250/417 (59%), Gaps = 10/417 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + +I+ Sbjct 3 RNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNSIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDE 124 AEL++ C I+S+ +++SG + N G+V I+ + E+ +EDVE V+ AK++ + + Sbjct 63 AAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSKTREINEEDVERVIEAAKAIVIPMD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +LHVIPQE+ +D IKNP+ + G+R++ VH+IT + ++N+V+ V R G VD+ Sbjct 123 REILHVIPQEFIVDGIPHIKNPIDMMGIRLEGGVHIITGSSSSSQNLVRCVNRAGFAVDE 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT DIA Sbjct 183 VVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + P AE IK+ G A SI+ + E+V +P++G RPP+ R+ L+ +I R E Sbjct 243 QVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRLRE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P++ Sbjct 303 IFEMMKAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLPMS 355 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I G+ + +P +S+A+GL+ Y E + + +L W KE+ Sbjct 356 INGIGEEHIDPKFSSALGLVLYKHEQQKFNKLKKVSSKVKRKNKISSKLKGWFLKEW 412 >gi|24194053|gb|AAN47810.1| Gene info Cell division protein ftsA [Leptospira interrogans serovar Lai str. 56601] gi|24213311|ref|NP_710792.1| Gene info Cell division protein ftsA [Leptospira interrogans serovar Lai str. 56601] Length=409 Score = 261 bits (668), Expect = 3e-68, Method: Composition-based stats. Identities = 140/411 (34%), Positives = 241/411 (58%), Gaps = 14/411 (3%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 +++ L++GT+ +V + + V IIG G+ PS G+ G + ++ES + + A+ + Sbjct 7 RIIAALDLGTSLTKVVVARPVSEYEVEIIGTGAYPSSGIKNGSIINIESTTRSIIEAVSE 66 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEH 125 AELM+ +IS V + ++GK + N G+V I+ + VT+ DV V+ A+++RV + Sbjct 67 AELMSGQEISVVAVNITGKTVKADNSKGVVAITNRDRTVTEPDVVRVIEAAQAIRVPADQ 126 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LHV+ +E+++D Q I++P+G++GVR++A+VH++T N+ K +E GL + + Sbjct 127 QILHVLSKEFSVDDQSSIRDPIGMTGVRLEAEVHIVTAGITAIHNLEKCIESSGLGCEVM 186 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I + LASS +VLT E++LG V+DIG G+ D+ VY G + ++ VIP+ G VTSDI+ Sbjct 187 ILSSLASSEAVLTSGEKDLGTAVLDIGAGSCDLIVYVDGGISYSSVIPFGGINVTSDISI 246 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T AE +K R+G + S + E++E+P + GRP R + R+ L +IEPR E+ Sbjct 247 GLKTTLETAELLKKRYGHTILSEIDPTETIEIPPISGRPARQVLREELVSIIEPRMREIF 306 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V++E L + G K LA G++LTGG + +EG+ A+ VF P IT Sbjct 307 EMVDKE-------LEKSGKKGFLAGGVILTGGGSLLEGIDTLAEDVFRLTSSRARPGGIT 359 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 GL + A P +STA+G++ Y +++++ W K++ W+ Sbjct 360 GLAEKASSPEFSTAIGMIKYADRM-----TDMDQKSVDRSEGWSKKIRRWI 405 >gi|51573132|gb|AAU07157.1| Gene info cell division protein [Borrelia garinii PBi] gi|51598561|ref|YP_072749.1| Gene info cell division protein [Borrelia garinii PBi] Length=413 Score = 260 bits (665), Expect = 6e-68, Method: Composition-based stats. Identities = 144/385 (37%), Positives = 242/385 (62%), Gaps = 10/385 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + +I+ Sbjct 3 RNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNSIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDE 124 AEL++ C I+S+ +++SG + N G+V I+ E+ +EDVE V+ AK++ + + Sbjct 63 AAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSRTREINEEDVERVIEAAKAIVIPMD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +LHVIPQE+ +D IKNP+ + G+R++ +VH+IT + ++N+V+ V R G VD+ Sbjct 123 REILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSSSSSQNLVRCVNRAGFAVDE 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT DIA Sbjct 183 VVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + P AE IK+ G A SI+ + E+V +P++G RPP+ R+ L+ +I R E Sbjct 243 QVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRLRE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P++ Sbjct 303 IFEIMRAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLPMS 355 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKE 388 I G+ + +P +S+A+GL+ Y E Sbjct 356 INGVGEKHIDPKFSSALGLVLYKHE 380 >gi|45658797|ref|YP_002883.1| Gene info FtsA [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|45602041|gb|AAS71520.1| Gene info FtsA [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length=409 Score = 260 bits (664), Expect = 8e-68, Method: Composition-based stats. Identities = 139/411 (33%), Positives = 240/411 (58%), Gaps = 14/411 (3%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 +++ L++GT+ +V + + V IIG G+ PS G+ G + ++ES + + A+ + Sbjct 7 RIIAALDLGTSLTKVVVARPVSEYEVEIIGTGAYPSSGIKNGSIINIESTTRSIIEAVSE 66 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEH 125 AELM+ +IS V + ++GK + N G+V I+ + VT+ DV V+ A+++RV + Sbjct 67 AELMSGQEISVVAVNITGKTVKADNSKGVVAITNRDRTVTEPDVVRVIEAAQAIRVPADQ 126 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LHV+ +E+++D Q I++P+G++GVR++A+VH++T N+ K +E GL + + Sbjct 127 QILHVLSKEFSVDDQSSIRDPIGMTGVRLEAEVHIVTAGITAIHNLEKCIESSGLGCEVM 186 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I + LASS +VLT E++LG V+DIG G+ D+ VY G + ++ VIP+ G VTSDI+ Sbjct 187 ILSSLASSEAVLTSGEKDLGTAVLDIGAGSCDLIVYVDGGISYSSVIPFGGINVTSDISI 246 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T AE +K R+G + S + E++E+P + GRP R + R+ L +IEPR E+ Sbjct 247 GLKTTLETAELLKKRYGHTILSEIDPTETIEIPPISGRPARQVLREELVSIIEPRMREIF 306 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V++E L + G K LA G++LTGG + +EG+ A+ VF P IT Sbjct 307 EMVDKE-------LEKSGKKGFLAGGVILTGGGSLLEGIDTLAEDVFRLTSSRARPGGIT 359 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 GL + A P +ST +G++ Y +++++ W K++ W+ Sbjct 360 GLAEKASSPEFSTTIGMIKYADRM-----TDMDQKSVDRSEGWSKKIRRWI 405 >gi|48854568|ref|ZP_00308730.1| COG0849: Actin-like ATPase involved in cell division [Cytophaga hutchinsonii] Length=459 Score = 247 bits (630), Expect = 8e-64, Method: Composition-based stats. Identities = 141/383 (36%), Positives = 224/383 (58%), Gaps = 11/383 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 K+VVGL+IGT K+ A+VG G + I+G+G S G+ +G V ++ V +++AI + Sbjct 17 KIVVGLDIGTTKICAIVGRKNEYGKLEILGIGKAVSEGVIRGMVTNINLTVTAIEKAIKE 76 Query 68 AELMADCQISSVYLALSGKHI--SCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 A + I V + ++G+HI S + P +EE++ +DV + + + Sbjct 77 ASDQSGIDIGVVNVGIAGQHIKSSVHHHGINRPGGDEEISVDDVNRLTADMYRTVMPFGN 136 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HV+PQ Y +DY+E IK+PVG++GVR++A H+IT + + KNI + V++ L +D L Sbjct 137 EIIHVMPQVYTVDYEENIKDPVGMTGVRLEADFHVITANTNAIKNINRCVQKGDLAIDNL 196 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I +ASS SVL+E+E+E GVC+VDIGGGT DIA++ +RHT VIP+ G+++TSDI Sbjct 197 ILEPIASSMSVLSEEEKEAGVCLVDIGGGTTDIAIFYDNIIRHTAVIPFGGDIITSDIKT 256 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 A+ +K++ G AL S ++ + V + RP + + + LA +I+ R E+L Sbjct 257 GCNIMHKQADELKIKFGSALASEARANDIITVKGLRDRPAKEISAKNLASIIQCRMEEIL 316 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV+ EI+ G + LA GIV+TGG AQ++ L + + RIG P Sbjct 317 ELVHSEII-------CSGYEDRLAGGIVITGGGAQLQNLKQLFELMTGQHTRIGYPNEHL 369 Query 366 G--LTDYAQEPYYSTAVGLLHYG 386 G T+ + P Y+TAVGL+ G Sbjct 370 GKSKTELVKSPMYATAVGLVLAG 392 >gi|76259137|ref|ZP_00766788.1| Cell division protein FtsA [Chloroflexus aurantiacus J-10-fl] gi|76165896|gb|EAO60025.1| Cell division protein FtsA [Chloroflexus aurantiacus J-10-fl] Length=415 Score = 246 bits (627), Expect = 2e-63, Method: Composition-based stats. Identities = 147/421 (34%), Positives = 246/421 (58%), Gaps = 19/421 (4%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 T + +VG+++GT+K+ +VG++ +NI+GVG PSRG+DKG V +++ ++ + Sbjct 4 TMARTIVGIDVGTSKICTIVGQIGDGRRLNILGVGMVPSRGIDKGVVVNIDDAATAIEAS 63 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE-VTQEDVENVVHTAKSVRVRD 123 +++AE + +IS ++ ++G+HIS N G+ + + +T++DV V A+ V + Sbjct 64 LEKAERASGLRISHAFVGVAGRHISSLNSRGVAAVQNPDGITRQDVARAVEAAQLVALPT 123 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + ++HVIP+ Y ID +GI++P+G+SG+R++ + H+IT +N++++VER G+++D Sbjct 124 QREIIHVIPRTYVIDGNDGIRDPIGMSGLRLEVETHIITGEAMAIQNLIRSVERAGVQID 183 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 L+ LA++ +VL++D++E GV ++DIGG T D+A++ G + HT VIP G T+DI Sbjct 184 DLVLQPLAAAEAVLSDDDKERGVMLIDIGGATTDLAIFAQGGVWHTGVIPVGGQHFTNDI 243 Query 244 AYAFGTPPSDAEAIKVRHGCALGS--IVGKDES----VEVPSVGGRPPRSLQRQTLAEVI 297 Y TPP+ AE +K+R+G A+ DES E +VG + + + L +V+ Sbjct 244 VYVLHTPPNTAEYLKLRYGSAIAGNPPAPGDESDLIDAETLTVGEK--QQISAHLLKQVL 301 Query 298 EPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVR 357 + R EL+ L+ E R+ G + L AGIVLTGG AQ+ + VR Sbjct 302 QARAEELIELIVAEA-------RRSGYEGMLPAGIVLTGGGAQLSRFDDLLRDDLGLPVR 354 Query 358 IGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLR 417 IG P + GLTD P Y+TAVGLL +G G E+ + S +R WLR Sbjct 355 IGIPGGLGGLTDSLDSPAYATAVGLLRWGVRY---GGRPPEQSSSDDTSSLYERFRRWLR 411 Query 418 K 418 + Sbjct 412 E 412 >gi|66798160|ref|ZP_00396916.1| Cell division protein FtsA [Deinococcus geothermalis DSM 11300] gi|66781526|gb|EAL82494.1| Cell division protein FtsA [Deinococcus geothermalis DSM 11300] Length=448 Score = 244 bits (622), Expect = 7e-63, Method: Composition-based stats. Identities = 142/382 (37%), Positives = 222/382 (58%), Gaps = 8/382 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D ++VGL+IGT K+ ++GEV P+G V+IIG GS PS GM +G V +LE +++++ Sbjct 3 DNPIIVGLDIGTTKITTVIGEVAPNGTVDIIGEGSVPSEGMKRGAVVNLERATHAIRQSV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISE-EEVTQEDVENVVHTAKSVRVRDE 124 AE ++ ++SSV+++++G H G+ I +++TQ DV+ + A++V + Sbjct 63 QSAERVSGVRVSSVFVSVAGNHAKAITSHGLAAIRRNQQITQADVDRSIENARAVPLDPN 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++H +PQEY +D QEGIKNPVG+ GVR++ VH++ N+ + V+ GLKV+ Sbjct 123 LEIIHTLPQEYVVDGQEGIKNPVGMHGVRLEVDVHIVAGTAGPLLNLRRCVQEAGLKVEG 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LAS + L E+ V V+D+GGGT D+ V+ G L H+ IP G VT+D+A Sbjct 183 FVLQALASGLATLEAAEQAQTVIVIDMGGGTTDVGVFKRGNLAHSACIPLGGEHVTADLA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 P +AE +K R+G AL + D ++E+ S G ++ L+ +I+PR TE+ Sbjct 243 QILKIPHEEAENVKRRYGSALPELADPDLTLEITSANG-ATHAISAFELSRIIKPRLTEI 301 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 +V +EI Q G +A +VLTGGA+Q+ G A+ F VR+G P I Sbjct 302 FGMVRDEIDQ------ALGPVELVAQSVVLTGGASQLRGTTELARDRFRLPVRLGRPRGI 355 Query 365 TGLTDYAQEPYYSTAVGLLHYG 386 GLTD P ++T VGL+ YG Sbjct 356 GGLTDIVSGPAHATGVGLVLYG 377 >gi|6458332|gb|AAF10210.1| Gene info cell division protein FtsA [Deinococcus radiodurans R1] gi|15805657|ref|NP_294353.1| Gene info cell division protein FtsA [Deinococcus radiodurans R1] Length=517 Score = 241 bits (616), Expect = 3e-62, Method: Composition-based stats. Identities = 132/382 (34%), Positives = 218/382 (57%), Gaps = 8/382 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + ++VGL+IGT K+ ++GEV PDG ++IIG GS PS GM +G V +LE + +++++ Sbjct 3 ENSIIVGLDIGTTKITTVIGEVAPDGTIDIIGEGSVPSEGMKRGSVINLERATQAIKQSL 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS-EEEVTQEDVENVVHTAKSVRVRDE 124 AE ++ + +V++++ G H G+ I ++E++ DVE + A++V + Sbjct 63 HAAERVSGVRAWNVFVSVGGNHTKAMTSHGLAAIRRQQEISPPDVERAIENARAVPLDPS 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +LH IPQEY +D QEGIKNPVG+ GVR++ VH++ N+ + V+ GL+++ Sbjct 123 LEILHTIPQEYVVDGQEGIKNPVGMHGVRLEVDVHIVAGSAGPLLNLRRCVQEAGLQIEG 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LAS + L E+ VVD+GGGT DI V+ G L H+ IP G+ VT+D+A Sbjct 183 FVLHSLASGLATLDHSEQNQTTVVVDMGGGTTDIGVFKRGNLAHSASIPIGGDHVTADLA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 P +AE +K +G A+ + ++ ++E+ + G ++ L+ VI PR +E+ Sbjct 243 QILKIPMEEAEKVKRHYGAAIPELADQELTLEITTASG-ATHAISAYELSRVIRPRVSEI 301 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L+ +EI Q G +A +VLTGG AQ+ G A+ F R+G P I Sbjct 302 YGLIRDEIDQ------ALGPVELVAQSVVLTGGGAQLPGAVDLARERFRLPTRLGRPRGI 355 Query 365 TGLTDYAQEPYYSTAVGLLHYG 386 GL+D +P ++ +VG++ YG Sbjct 356 HGLSDIVGDPAHACSVGMVLYG 377 >gi|77996717|gb|ABB15616.1| Gene info cell division protein FtsA [Carboxydothermus hydrogenoformans Z-2901] gi|78044602|ref|YP_360880.1| Gene info cell division protein FtsA [Carboxydothermus hydrogenoformans Z-2901] Length=410 Score = 236 bits (603), Expect = 1e-60, Method: Composition-based stats. Identities = 131/379 (34%), Positives = 219/379 (57%), Gaps = 9/379 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++L+ +++G++K+ AL+GE+ DG V ++GVG S G+ KG + D++ VK ++ +++ Sbjct 4 KELIAVVDVGSSKIVALIGEIAADGQVTLLGVGETASSGIKKGAIVDIDGTVKAIKTSLE 63 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 +AE + ++S ++ + + N +V ++ E E+T EDV V++ K V + + Sbjct 64 KAEQIVGYGLTSAVVSFTSPSLISLNNKSVVAVTNLEREITSEDVNRVLNATKIVPIPPD 123 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +++ IP+ Y +D G+ +PVG++G R++A+ H+I N+ K + GL V + Sbjct 124 KKIIKAIPRFYTVDGFAGVVDPVGMTGSRLEAETHIIAVAQSTFANLQKVASKAGLNVLE 183 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 I A LAS+ VL E+ELG ++DIG GTMD+A+Y+ G+L T IP +T+D+A Sbjct 184 FIPAILASAEVVLYPAEKELGCLLIDIGAGTMDLAIYSEGSLFFTGAIPVGDQYITNDLA 243 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 TP + AE IK+ G AL S+V DE +EV +VGG + + +Q +A +IE R E+ Sbjct 244 IGLRTPIAVAEKIKIEAGTALASLVQNDEYLEVENVGGTEKQKVSKQMVAAIIEARVREM 303 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L L +EI R G L G+++TGG A + G+ AQ +F VRIG P + Sbjct 304 LELALKEI-------RSSGFTGLLPGGVIITGGGAMLPGIKEVAQEIFDLPVRIGVPEGL 356 Query 365 TGLTDYAQEPYYSTAVGLL 383 + L P Y++A+G L Sbjct 357 SNLPVNLINPRYASAIGAL 375 >gi|42526712|ref|NP_971810.1| Gene info cell division protein FtsA [Treponema denticola ATCC 35405] gi|41817027|gb|AAS11721.1| Gene info cell division protein FtsA [Treponema denticola ATCC 35405] Length=414 Score = 234 bits (598), Expect = 4e-60, Method: Composition-based stats. Identities = 137/416 (32%), Positives = 227/416 (54%), Gaps = 19/416 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL+IG+ + +V E +G + I G+G S G+ +G V ++E+ V+ + +A+D+A Sbjct 5 IIVGLDIGSKNIRVVVAEKNDEGHLQITGIGMSESTGIHRGIVTNIENTVQGINKAVDEA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE-----EVTQEDVENVVHTAKSVRVRD 123 E+M+ IS + L G HI N G+ PI ++ E+ + D++ V+++A++V Sbjct 65 EVMSGVDISHCTVGLGGVHIEGVNSKGVFPIRDKGKNNKEIDRSDIDAVINSAQAVEFTG 124 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + ++HV+PQ Y +D Q GIK+P+ + G R++A+VHLIT KNI V+R L +D Sbjct 125 DREIIHVVPQSYTVDRQRGIKDPLNMIGTRLEAEVHLITGVATSMKNIPNCVQRADLNID 184 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 L+ GLA +V+T DE+ELG ++DIG GT DI V G T +P G VT+D+ Sbjct 185 GLMHNGLADVRAVMTNDEQELGSILIDIGAGTTDIVVMQNGGPIITAALPVGGIQVTNDL 244 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A P AE IK+ GC V +DE V +P+ GGR P + R + E+++ R E Sbjct 245 AIVKSIPFDTAEKIKISSGCCWMPFVERDEQVLIPAFGGRGPEEIYRSEICEILQARMAE 304 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ-VRIGAPL 362 + +V ++ L + R L +++ GG A + G A +F Q R+G P Sbjct 305 IFVMVKNKVDDLTQGSR-------LGGSVIICGGGALLNGTTELADEIFGMQSARLGIPS 357 Query 363 NITGLTDYAQEPYYSTAVGL-LHYGKESHLNGEAEVEKR-----VTASVGSWIKRL 412 I G+ + P ++T +GL LH + + G+ ++ V + + ++IK L Sbjct 358 TIGGVVGRYRSPEFATVLGLILHRLDDQNKIGKVSSSRKENSGLVVSKIKNFIKEL 413 >gi|10175179|dbj|BAB06278.1| Gene info cell-division protein (septum formation) [Bacillus halodurans C-125] gi|15615122|ref|NP_243425.1| Gene info cell-division protein (septum formation) [Bacillus halodurans C-125] Length=425 Score = 233 bits (594), Expect = 1e-59, Method: Composition-based stats. Identities = 134/385 (34%), Positives = 219/385 (56%), Gaps = 20/385 (5%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + ++ V L+IGT+ V ++GE+ DG +NIIGVG+ PS G+ KG + D++ V+ ++RA+ Sbjct 3 NNEIYVSLDIGTSNVRIIIGEI-TDGSINIIGVGNAPSEGIKKGSIVDIDETVRSIRRAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRD 123 +QAE M I V + ++G H+ Q G+V +S + E+ ED+ V+ A+ V + Sbjct 62 EQAERMVGLSIRQVIVGVNGNHVQLQPCHGVVAVSSPDREIGDEDIARVIDAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P G+ GVR++ + +IT + N+++ VER GL+V Sbjct 122 EREIIDVIPKQFIVDGLDEINDPRGMIGVRLEMEGTIITGSKTLLHNLLRCVERAGLEVA 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ +++DE+ LGVC++DIGGG+M I+ + G+L T VIP G+ VT+DI Sbjct 182 DICLQALAAGSVAISKDEKSLGVCLIDIGGGSMTISCFEQGSLVDTSVIPVGGDHVTNDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A +A IK HG A +++ EV ++G P + + LA +IEPR E Sbjct 242 AVGLRISTEEAIKIKHTHGHAYIDEASEEDRFEVKAIGSTEPEAFSQFELAHIIEPRMEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + L+N E LR+ G +H G VLTGG+ + G+ A+ VR+ P Sbjct 302 MFELINRE-------LRRLG-QHDFPGGFVLTGGSVMMPGVLELAKETLGRNVRVAIP-- 351 Query 364 ITGLTDY--AQEPYYSTAVGLLHYG 386 DY +EP Y+T VGL+ + Sbjct 352 -----DYIGVREPQYTTGVGLIQFA 371 >gi|78170241|gb|ABB27337.1| Gene info Cell division protein FtsA [Chlorobium chlorochromatii CaD3] gi|78188042|ref|YP_378380.1| Gene info Cell division protein FtsA [Chlorobium chlorochromatii CaD3] Length=435 Score = 231 bits (590), Expect = 4e-59, Method: Composition-based stats. Identities = 131/389 (33%), Positives = 224/389 (57%), Gaps = 11/389 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT KV +V E G +N++G G S G+ + V ++ V ++ A+ A Sbjct 6 IAVGLDIGTTKVCVVVAEKDESGKLNVLGKGRSNSDGLQRATVVNINKTVASIKAAVADA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C + + I++ + E DV + AK+ +R D +H Sbjct 66 ERESSIRIRGVNVGISGAHVHCIHSNSEISINQTGIVNESDVRRFLEKAKTNIRYLDIDH 125 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + VE+ GL++ + Sbjct 126 EIIHVIPQEFIVDDQEGLLDPIGMAGTTMRGSAYIVVGLKTKIRNIRQCVEKAGLEISAI 185 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +V+ E E++ GV V+DIGGGT ++A+Y GA+R+++VI AGN VT DIA+ Sbjct 186 TFEPVASGMAVMKEREKKSGVVVIDIGGGTTEVALYIDGAIRYSEVIKVAGNDVTHDIAH 245 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE +K++HGCA ++G DE + + + GRP +S+ + +L +IE R E+L Sbjct 246 GIRALYEVAEDLKIKHGCAHSKLMGDDEELLIEGIEGRPQKSVPKSSLTMIIEARMLEIL 305 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV + I ++ G +L AG ++TGG + + G A V VR G P ++ Sbjct 306 ELVRDSI-------KRSGYYEYLNAGAIITGGGSLLPGTEELAHEVLGLDVRKGTPEGVS 358 Query 366 -GLTDYAQEPYYSTAVGLLHYGKESHLNG 393 G+ + P Y+T +GL+ + E++L+ Sbjct 359 GGIKEAVNNPMYATVMGLVAHSFENNLSA 387 >gi|88801283|ref|ZP_01116811.1| cell division protein FtsA [Polaribacter irgensii 23-P] gi|88781941|gb|EAR13118.1| cell division protein FtsA [Polaribacter irgensii 23-P] Length=442 Score = 231 bits (588), Expect = 5e-59, Method: Composition-based stats. Identities = 138/406 (33%), Positives = 232/406 (57%), Gaps = 8/406 (1%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D K+ VGL+IGT K+ A++G + +IG+G S G+ +G V+++ ++ +Q+A+ Sbjct 3 DNKIAVGLDIGTTKIIAMIGRKNEYNKIEVIGIGKAKSLGVKRGVVSNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHI-SCQNEIGMVPISEEEVTQE-DVENVVHTAKSVRVRD 123 ++AE ++ +I V + ++G+HI S + + + +EV +E D+EN+V+ + + Sbjct 63 EEAESVSGMKIEDVIVGIAGQHIRSLHHSDYITRNNADEVIEEADIENLVNQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQE+ +D Q IK P+G+ G R++A H++ +NI + V+ GL++ Sbjct 123 GEEIIHVLPQEFKVDSQADIKEPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLELS 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LAS+ +VL+ +E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 DITLEPLASASAVLSLEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A + E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKETEIVSIPGLRGREPKEITLKNLSKIIHARVQE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + + K L AGIVLTGG AQ++ L + + R+G P Sbjct 303 IIEQVYLEI----KNYGHETAKGKLIAGIVLTGGGAQLKHLRQLVEYITGMDARVGFPNE 358 Query 363 NITGLTDYA-QEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS 407 ++ G +D A P Y+TAVGLL G GEA VE+ + V S Sbjct 359 HLAGDSDEALSSPAYATAVGLLMEGLNKEFKGEAVVEEVLDEDVRS 404 >gi|67938385|ref|ZP_00530911.1| Cell division protein FtsA [Chlorobium phaeobacteroides BS1] gi|67915362|gb|EAM64684.1| Cell division protein FtsA [Chlorobium phaeobacteroides BS1] Length=428 Score = 230 bits (587), Expect = 6e-59, Method: Composition-based stats. Identities = 134/387 (34%), Positives = 215/387 (55%), Gaps = 11/387 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT KV +V E G +NI+G G S G+ + V ++ V ++ A+ A Sbjct 6 IVVGLDIGTTKVCVVVAERDEIGKLNILGQGRSDSEGLQRATVVNINKTVDAIKSAVADA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEE-VTQEDVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C N + +++ V DV + AK+ +R D +H Sbjct 66 ERESSIRIRGVNVGISGAHVHCINSNSEISVNQSGIVNASDVRRFLEKAKTNIRYLDIDH 125 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + VE+ GL+V+ + Sbjct 126 EIIHVIPQEFIVDDQEGVLDPIGMAGTTMRGSAYIVVGMKTKIRNIKQCVEKAGLEVNAM 185 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +V+ E E++ GV ++DIGGGT ++A+Y GA+R ++VI A N VT D+AY Sbjct 186 TFEPIASGLAVMKESEKKSGVVIIDIGGGTTEVAIYIDGAIRFSEVIKVAANDVTHDVAY 245 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE +K++HG A DE + V + GRP +S R +L +IE R E+ Sbjct 246 GIKALYEVAEEVKIKHGSASTGNSAADEEILVEGIEGRPRKSFMRSSLTLIIEARMMEIF 305 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ E ++ + G +L AG+V+TGG I G A RV VR G P ++ Sbjct 306 ELIREVVM-------RSGYFEYLNAGVVITGGGCLIPGTDDLAARVLGLDVRSGFPEGVS 358 Query 366 -GLTDYAQEPYYSTAVGLLHYGKESHL 391 G+ P Y+T +GL+ Y E+ L Sbjct 359 GGMKGAINSPIYATVMGLVAYSLENSL 385 >gi|46199031|ref|YP_004698.1| Gene info cell division protein ftsA [Thermus thermophilus HB27] gi|46196655|gb|AAS81071.1| Gene info cell division protein ftsA [Thermus thermophilus HB27] Length=411 Score = 230 bits (587), Expect = 7e-59, Method: Composition-based stats. Identities = 136/379 (35%), Positives = 219/379 (57%), Gaps = 8/379 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++ GL++GT KV ++GE+ PDG+++IIG G+ PS+G+ +G V +LE + +++++ QA Sbjct 2 IIAGLDVGTTKVTTVIGELAPDGVLDIIGEGTVPSQGLRRGVVVNLERTTEAIRQSLFQA 61 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISE-EEVTQEDVENVVHTAKSVRVRDEHRV 127 E +A ++ V + + G H+ G+ I + + DVE + AK+ E + Sbjct 62 ERVAGVKVERVVVGVGGPHLKSVTSHGLAAIRRGHTIAEADVERAIEQAKAYPFEGELEL 121 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 LH +P E+ +D QEGI++PVG++GVR++ VHLI N+ +AVE GL +D + Sbjct 122 LHALPLEFKVDGQEGIRDPVGMAGVRLEVDVHLIAAGRGPLANLRRAVEEAGLALDAVCV 181 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 LAS +VLT +E E+ V ++DIGGGT D+AV+ GG L H+ V+P G+ VT DIA Sbjct 182 QALASGLAVLTPEEEEMTVLLLDIGGGTTDVAVFRGGRLAHSAVVPLGGDHVTHDIAQLL 241 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNL 307 P +AE +K ++G AL + + +E+ GG + LA +I PR E+L+L Sbjct 242 KIPFEEAERVKRKYGAALPELADPELVLEINQEGG-ALGEVPAPELARIIRPRMREILHL 300 Query 308 VNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGL 367 + + + L Q + +VLTGG A + G A++ + VR+G P ++GL Sbjct 301 ARQSVDETLGPLEIQVNR------VVLTGGGALLRGTDLLARQQYGLPVRVGKPQGVSGL 354 Query 368 TDYAQEPYYSTAVGLLHYG 386 TD P ++ AVGL+ YG Sbjct 355 TDVVASPAHAAAVGLVRYG 373 >gi|78167850|gb|ABB24948.1| Gene info Cell division protein FtsA [Pelodictyon luteolum DSM 273] gi|78187948|ref|YP_375991.1| Gene info Cell division protein FtsA [Pelodictyon luteolum DSM 273] Length=441 Score = 230 bits (586), Expect = 9e-59, Method: Composition-based stats. Identities = 137/390 (35%), Positives = 215/390 (55%), Gaps = 11/390 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT KV +V E G +N++G G S G+ + V ++ V+ ++ A+ A Sbjct 12 IAVGLDIGTTKVCVVVAEKDARGKLNLLGRGLAASEGLQRATVVNINKTVEAIRLAVADA 71 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV-TQEDVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C + I++ V T+ DV + A+S +R D E+ Sbjct 72 ERESSIRIGRVNVGISGTHVHCIPSTSEISINQTGVVTESDVRRFLEKARSNIRYLDIEN 131 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQ + +D QEG+ +P+G++G M+ ++ +NI + VE+ GL+V + Sbjct 132 EIIHVIPQTFTVDDQEGLPDPIGMAGTTMKGSACIVVGQKTKIRNIRQCVEKAGLEVGAI 191 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +VL E ER+ GV V+DIGGGT ++AVY GA+ ++ VI AGN VT DIAY Sbjct 192 TFEPIASGLAVLRESERKSGVAVIDIGGGTTEVAVYLDGAIHYSDVIKVAGNDVTGDIAY 251 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T AE +K+ +GCA G G+DE + V + GRP + R +L +IE R TE+ Sbjct 252 GVKTLHGIAEELKIAYGCAYGPESGQDEELVVEGIEGRPSKYFPRSSLTLIIEARMTEIF 311 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V ++ L Q G L AG ++TGG + + A R+ VR G P ++ Sbjct 312 EMV-------RDSLNQSGFYDALHAGAIITGGGSLLRATEPLASRILGLDVRTGCPEGVS 364 Query 366 -GLTDYAQEPYYSTAVGLLHYGKESHLNGE 394 G+ + P Y+T GL+ + E L E Sbjct 365 GGIRGAVESPIYATVTGLVGHAFEHALTVE 394 >gi|21645923|gb|AAM71279.1| Gene info cell division protein FtsA [Chlorobium tepidum TLS] gi|21672872|ref|NP_660937.1| Gene info cell division protein FtsA [Chlorobium tepidum TLS] Length=447 Score = 229 bits (585), Expect = 1e-58, Method: Composition-based stats. Identities = 130/387 (33%), Positives = 223/387 (57%), Gaps = 11/387 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT KV +V E G +N++G G S G+ + V ++ V +++A+ A Sbjct 12 IVVGLDIGTTKVCVVVAEKDDVGKLNVLGKGRANSEGLQRATVVNINKTVDAIRKAVADA 71 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C + +++ + E DV + AK+ +R D +H Sbjct 72 ERESSIKIKGVNVGISGAHVHCIYSNSEISVNQSGIVNESDVRRFLEKAKTNIRYLDIDH 131 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQE+ +D Q+G+ +P+G++G M+ +++ +NI + +E+ GL+V + Sbjct 132 EIIHVIPQEFIVDDQDGVLDPIGMAGTIMRGSAYIVVGLRTKIRNIKQCIEKAGLEVSAM 191 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +V+ E ER GV V+DIGGGT ++A+Y GA+R+++VI A N VT D+AY Sbjct 192 TFEPVASGLAVMKESERRSGVVVIDIGGGTTEVAIYIDGAIRYSEVIKVAANDVTHDVAY 251 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE IK++HGCA ++ K+E + + S+ GRP +S + +L +IE R E+ Sbjct 252 GIKALNDVAEEIKIQHGCAYAKVLDKEEEILIESIEGRPSKSFPKSSLTVIIEARMMEIF 311 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV + I ++ G +L AG+++TGG A + G A+ + VR G P ++ Sbjct 312 ELVRDII-------KRSGYYDYLNAGVIITGGGALLPGTGELARDILGLDVRTGYPEGVS 364 Query 366 -GLTDYAQEPYYSTAVGLLHYGKESHL 391 G+ D P Y+T +GL+ + +++L Sbjct 365 GGIKDAINNPMYATVMGLVAHSLQNNL 391 >gi|20516649|gb|AAM24842.1| Gene info predicted ATPases of the HSP70 class involved in cell division [Thermoanaerobacter tengcongensis MB4] gi|20808067|ref|NP_623238.1| Gene info predicted ATPase of the HSP70 class involved in cell division [Thermoanaerobacter tengcongensis MB4] Length=408 Score = 229 bits (584), Expect = 2e-58, Method: Composition-based stats. Identities = 134/380 (35%), Positives = 224/380 (58%), Gaps = 15/380 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT+KV ++GE G ++I+G+G PS G+ KG + D++ +Q++++QA Sbjct 4 LIVGLDIGTSKVCTIIGEGDKTGELHIVGIGYYPSTGVKKGIIVDIDETAYSIQKSVEQA 63 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHR 126 E MA+ +ISSVYL + G + G+V +S E E+T++DVE V+ AK + + + + Sbjct 64 ERMANRKISSVYLKIYGGLTTIYKNNGVVAVSREDREITRQDVERVLQAAKIIALPSDKQ 123 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++ VIP EY +D IK+PVG+SG+R++ ++T +N+ K V + GL++D +I Sbjct 124 IIDVIPLEYIVDGYGEIKDPVGMSGIRLEVNAAVVTGSVTAIQNMEKCVRKAGLEIDGII 183 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LA+S +VL +DE+ELGV ++D+G G DI+V+ G L ++ +I G +T+D++ Sbjct 184 VGPLATSEAVLLKDEKELGVALIDVGAGVTDISVFKNGGLIYSSMIAVGGWHITNDLSVG 243 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 +AE IK ++G + E +++ S+ G+ + +A++IE R +ELL Sbjct 244 LKISFEEAENIKKKYGTLEKVDPDRLEPIKIASLAGKSKTTTDINEIADIIEARVSELLT 303 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ-IEGLAACAQRVFHTQVRIGAPLNIT 365 LV E+L + GV + +V+TGG ++G AQ++F VRIG+P NI Sbjct 304 LV-------YERLEEAGVLEDIVTNVVITGGGISFLKGSVELAQKIFDRNVRIGSPQNIG 356 Query 366 GLTDYAQEPYYSTAVGLLHY 385 T P YS VG++ Y Sbjct 357 VAT-----PIYSAGVGVVKY 371 >gi|57225356|gb|AAW40413.1| Gene info cell division protein FtsA [Dehalococcoides ethenogenes 195] gi|57234908|ref|YP_181089.1| Gene info cell division protein FtsA [Dehalococcoides ethenogenes 195] Length=408 Score = 229 bits (584), Expect = 2e-58, Method: Composition-based stats. Identities = 135/383 (35%), Positives = 225/383 (58%), Gaps = 12/383 (3%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++V +++GT K+ ++ EV P G VN++GVG PS+G+ KG V ++ + ++ +I + Sbjct 4 RIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKGLVVNINDARESIRESIRK 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEH 125 AE + ++ S Y+ ++G+H++ N G+V I+ + V +D++ V+ TA+++ V ++ Sbjct 64 AEQASGYKVESAYVGVTGRHVASMNNRGVVAITRNDRLVRSDDLKRVMATAQNISVPNDR 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LHVIP+ YA+D Q G+KNPVG+ G R+ + H+IT +N+VK + G+ +D L Sbjct 124 KLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAATSVQNLVKCIRGLGIDIDDL 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + +ASS +VLTEDE+++GV + DIGGGT DI ++ G++ HT +IP AG +T D+A Sbjct 184 VLEPIASSEAVLTEDEKQVGVILADIGGGTTDICIFKDGSIWHTAIIPVAGYQLTRDVAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 G P AE +K R+G L K ES PS + Q L ++I R E+L Sbjct 244 GLGLPFDVAEEMKKRYGSVLPVYETKMES---PSPICEDGHGVSYQDLCDIIRARVEEVL 300 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ EI + AG+VLTGG++ + G+ + + VR+G P + Sbjct 301 RLIMLEI-------PNSDYDSLVPAGLVLTGGSSNLAGMETLGRDILRIPVRVGNPDKVY 353 Query 366 GLTDYAQEPYYSTAVGLLHYGKE 388 G+ D +P Y+T VGLL +G + Sbjct 354 GIVDSLHDPAYATGVGLLIWGAK 376 >gi|73659908|emb|CAI82515.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] gi|73748192|ref|YP_307431.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] Length=408 Score = 229 bits (583), Expect = 2e-58, Method: Composition-based stats. Identities = 135/383 (35%), Positives = 225/383 (58%), Gaps = 12/383 (3%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++V +++GT K+ ++ EV P G VN++GVG PS+G+ KG V ++ + ++ +I + Sbjct 4 RIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKGLVVNINDARESIRESIRK 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEH 125 AE + ++ S Y+ ++G+H++ N G+V I+ + V +D++ V+ TA+++ V ++ Sbjct 64 AEQASGYKVESAYVGVTGRHVTSMNNKGVVAITRNDRLVRSDDLKRVMATAQNISVPNDR 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LHVIP+ YA+D Q G+KNPVG+ G R+ + H+IT +N+VK + G+ +D L Sbjct 124 KLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAATSVQNLVKCIRGLGIDIDDL 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + +ASS +VLT+DE+++GV + DIGGGT DI V+ G++ HT +IP AG +T D+A Sbjct 184 VLEPIASSEAVLTDDEKQVGVILADIGGGTTDICVFKDGSIWHTAIIPVAGYQLTRDVAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 G P AE +K R+G L K ES PS + Q L ++I R E+L Sbjct 244 GLGLPFDVAEEMKKRYGSVLPVYETKMES---PSPICEDGHGVSYQDLCDIIRARVEEVL 300 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ EI + AG+VLTGG++ + G+ + + VR+G P + Sbjct 301 RLIMLEI-------PNSDYDSLVPAGLVLTGGSSNLAGMETLGRDILRIPVRVGNPDKVY 353 Query 366 GLTDYAQEPYYSTAVGLLHYGKE 388 G+ D +P Y+T VGLL +G + Sbjct 354 GIVDSLHDPAYATGVGLLLWGAK 376 >gi|86134324|ref|ZP_01052906.1| cell division protein FtsA [Tenacibaculum sp. MED152] gi|85821187|gb|EAQ42334.1| cell division protein FtsA [Tenacibaculum sp. MED152] Length=441 Score = 229 bits (583), Expect = 2e-58, Method: Composition-based stats. Identities = 129/387 (33%), Positives = 225/387 (58%), Gaps = 8/387 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D K+ VGL+IGT K+ A++G G + ++G+G S G+ +G V+++ ++ +Q+A+ Sbjct 3 DNKIAVGLDIGTTKIVAMIGRKNEYGKIEVVGIGKAKSLGVKRGVVSNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVRVRD 123 D+AE ++ +I V + ++G+HI + + ++E + + D+E++V+ + + Sbjct 63 DEAESVSGVKIEDVVVGIAGQHIRSLHHSDYITRNNADEVIDEADIEDLVNQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQE+ +D Q IK P+G+ G R++A H++ +NI + V+ GL ++ Sbjct 123 GEEIIHVLPQEFKVDSQADIKEPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLDLN 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 EITLEPLASAQAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A + E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKETEIVSIPGLRGREPKEITLKNLSKIIHARVQE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + + K L AGIVLTGG +Q++ L + + RIG P Sbjct 303 IIEHVYLEI----KNYGHETAKGKLIAGIVLTGGGSQLKHLRQLVEYITGMDARIGYPNE 358 Query 363 NITGLTDYA-QEPYYSTAVGLLHYGKE 388 ++ G +D A P Y+TAVGLL G E Sbjct 359 HLAGESDEALSSPSYATAVGLLMEGLE 385 >gi|55772470|dbj|BAD70911.1| Gene info cell division protein FtsA [Thermus thermophilus HB8] gi|55981057|ref|YP_144354.1| Gene info cell division protein FtsA [Thermus thermophilus HB8] Length=411 Score = 228 bits (582), Expect = 3e-58, Method: Composition-based stats. Identities = 135/378 (35%), Positives = 218/378 (57%), Gaps = 8/378 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++ GL++GT KV ++GE+ PDG+++IIG G+ PS+G+ +G V +LE + +++++ QA Sbjct 2 IIAGLDVGTTKVTTVIGELAPDGVLDIIGEGTVPSQGLRRGVVVNLERTTEAIRQSLFQA 61 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISE-EEVTQEDVENVVHTAKSVRVRDEHRV 127 E +A ++ V + + G H+ G+ I + + DVE + AK+ E + Sbjct 62 ERVAGVKVERVVVGVGGPHLKSVTSHGLAAIRRGHTIAEADVERAIEQAKAYPFEGELEL 121 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 LH +P E+ +D QEGI++PVG++GVR++ VHLI N+ +AVE GL +D + Sbjct 122 LHALPLEFKVDGQEGIRDPVGMAGVRLEVDVHLIAAGRGPLANLRRAVEEAGLALDAVCV 181 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 LAS +VLT +E E+ V ++DIGGGT D+AV+ GG L H+ V+P G+ VT DIA Sbjct 182 QALASGLAVLTPEEEEMTVLLLDIGGGTTDVAVFRGGRLAHSAVVPLGGDHVTHDIAQLL 241 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNL 307 P +AE +K ++G AL + + +E+ GG + LA +I PR E+L+L Sbjct 242 KIPFEEAERVKRKYGAALPELADPELVLEINQEGG-ALGEVPAPELARIIRPRMREILHL 300 Query 308 VNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGL 367 + + + L Q + +VLTGG A + G A++ + VR+G P ++GL Sbjct 301 ARQSVDETLGPLEIQVNR------VVLTGGGALLRGTDLLARQQYGLPVRVGKPQGVSGL 354 Query 368 TDYAQEPYYSTAVGLLHY 385 TD P ++ AVGL+ Y Sbjct 355 TDVVASPAHAAAVGLVRY 372 >gi|57224977|gb|AAW40034.1| Gene info cell division protein FtsA [Dehalococcoides ethenogenes 195] gi|57234529|ref|YP_181379.1| Gene info cell division protein FtsA [Dehalococcoides ethenogenes 195] Length=400 Score = 228 bits (580), Expect = 5e-58, Method: Composition-based stats. Identities = 128/379 (33%), Positives = 213/379 (56%), Gaps = 17/379 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R+ + +++GT+K+ ++ + +G + I+GVG SRGM KG V +L + ++ ++ Sbjct 3 RRQIAAIDVGTSKICTVMADT-ENGDLRILGVGVVASRGMQKGMVVNLNEAKEAIRESVS 61 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDE 124 AE A ++ S + ++GKHI+ +N G++ I+ + V Q D++ + A S+ + + Sbjct 62 MAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVRQSDLQRAIDIASSITMPQD 121 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +VLH+IP+ Y++D QEG+ NPVG+ G R+ + H+IT ++ +N+ K + G+++D Sbjct 122 RKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITAASNSIENLTKCIRAAGVEIDD 181 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 L+F LAS+ + LT++ERE GV + DIGGGT DIA + G ++ HT V+P AG+ VT DI+ Sbjct 182 LVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAFKGNSIYHTSVLPIAGSQVTHDIS 241 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 G P A+ IK R+ + VE P L E++ R EL Sbjct 242 VGLGIPFEMADDIKQRYSSVIPGECNDASFVESGHTFSYP-------DLCEIVRMRVEEL 294 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L L IL+L + V +G+V+TGG A + G+A V VR+G P N+ Sbjct 295 LRLT---ILELPSDDYSKMV----PSGLVITGGTANLPGIAELGSEVLRIPVRVGTPPNL 347 Query 365 TGLTDYAQEPYYSTAVGLL 383 G++D +P + VG+L Sbjct 348 FGVSDILNDPACTNVVGML 366 >gi|89099617|ref|ZP_01172492.1| cell division protein (septum formation) [Bacillus sp. NRRL B-14911] gi|89085770|gb|EAR64896.1| cell division protein (septum formation) [Bacillus sp. NRRL B-14911] Length=426 Score = 227 bits (578), Expect = 8e-58, Method: Composition-based stats. Identities = 136/391 (34%), Positives = 223/391 (57%), Gaps = 21/391 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V +++AI+Q Sbjct 5 EIYVSLDIGTSSVKVIIGEMVNDSL-NIIGVGNVKSEGLRKGSIVDIDETVHSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M +I V + ++G H+ Q G+V +S + E+T EDV V+ A+ V + E Sbjct 64 AERMIGMEIRQVIVGITGNHVMLQPSHGVVAVSSDNREITDEDVARVIDAAQVVSIPPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++ VIP+++ +D I +P G+ GVR++ + +IT + NI++ VER GL++ + Sbjct 124 EIVDVIPKQFIVDGLNEINDPRGMIGVRLEMEGTIITGSKTILHNILRCVERAGLEILDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA+ L++DE LGV +VD+GGG+ +A++ G ++ T V+P G+ +T D++ Sbjct 184 TLQPLAAGAFALSKDEMNLGVALVDMGGGSTTVALFEQGIMKATIVLPVGGDHITKDLSI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T DAE IK ++G A +DE VP +G + + ++++IE R E+ Sbjct 244 GLRTSTEDAEKIKTKYGYAFYDHASEDEVFSVPIIGSDQHQQFNQLEISDIIEARMEEIF 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +L+ EI +L GV L G VLTGG A +G+ AQ +F +VRI P Sbjct 304 DLIQNEIKRL-------GVS-DLPGGYVLTGGVANTQGILELAQIIFQNRVRIAIP---- 351 Query 366 GLTDY--AQEPYYSTAVGLLHYG-KESHLNG 393 DY +EP Y+TAVGL+ + K + L G Sbjct 352 ---DYIGVREPQYTTAVGLIKFAYKNARLQG 379 >gi|68552729|ref|ZP_00592115.1| Cell division protein FtsA [Prosthecochloris aestuarii DSM 271] gi|68240352|gb|EAN22627.1| Cell division protein FtsA [Prosthecochloris aestuarii DSM 271] Length=452 Score = 227 bits (578), Expect = 9e-58, Method: Composition-based stats. Identities = 129/384 (33%), Positives = 216/384 (56%), Gaps = 11/384 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT KV +V E G +NI+G G S G+ + V ++ V ++ A+ A Sbjct 27 IVVGLDIGTTKVCVVVAEKDEVGKLNILGHGRSVSEGLQRATVVNINKTVNAIRAAVADA 86 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C N + +++ V D++ + AK+ +R D +H Sbjct 87 ERESSIRIKGVNVGISGAHVHCINSNSEISVNQSGVVNSSDIKRFLEKAKTNIRYLDIDH 146 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + VE+ GL V+ + Sbjct 147 EIIHVIPQEFIVDDQEGVLDPIGMAGTTMRGSAYIVVGMKTKIRNIKQCVEKAGLSVNDM 206 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +V+ E ER+ GV ++DIGGGT ++A+Y GA+R ++VI A N VT D+A+ Sbjct 207 TFEPVASGLAVMKESERKSGVVIIDIGGGTTEVAIYIDGAIRFSEVIKVAANDVTHDVAF 266 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE +K++HGCA +DE + + + GRP +S + +L +IE R E+ Sbjct 267 GVKALYEVAEDLKIKHGCAYIRDRSQDEEILIQGIEGRPQKSFLKSSLTLIIEARMMEIF 326 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ + I ++ G +L AG ++TGG + I G A + V VR G P I+ Sbjct 327 ELIRDSI-------KRSGYYEYLNAGAIITGGGSLIPGTDALSTEVLGLDVRTGYPEGIS 379 Query 366 GLTDYA-QEPYYSTAVGLLHYGKE 388 G ++ P Y+T +GL+ + E Sbjct 380 GGIKHSINNPMYATVMGLVAHSFE 403 >gi|34482388|emb|CAE09389.1| Gene info CELL DIVISION PROTEIN FTSA [Wolinella succinogenes] gi|34556674|ref|NP_906489.1| Gene info CELL DIVISION PROTEIN FTSA [Wolinella succinogenes DSM 1740] Length=467 Score = 226 bits (577), Expect = 1e-57, Method: Composition-based stats. Identities = 124/396 (31%), Positives = 230/396 (58%), Gaps = 9/396 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 + ++G++IG+ K+ ++ ++ DG+ ++IG G S+G+ KG + ++E + ++ AI+ Sbjct 3 QTILGIDIGSTKICTIIADI-KDGVPHVIGTGIHKSQGLKKGAITNIELASRAIKSAIND 61 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTA-KSVRVRDEHR 126 A+ +A S +++SG + N G+V I E+ +++ V+ TA + + +E+ Sbjct 62 AKRVAGTNFSKAIVSISGVYTKSINSSGIVNIPNSEIGIKEINRVMQTALYNATIPNEYE 121 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLHV+P + +D Q+ I +P+G+SG R++ VH++T N+ KAV+ G++++ ++ Sbjct 122 VLHVLPYNFKVDDQDFIDDPLGMSGNRLEVFVHIVTAQRSSLGNLKKAVKAAGVEIENIV 181 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 + AS+ +VL +DE+ELGV +D+GG T D+ V+ G ++++ + N +T+D++ A Sbjct 182 LSAYASAIAVLNDDEKELGVACIDMGGSTCDLMVHAGNSIKYNDFLGVGSNHITNDLSMA 241 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP S AE +KV +G + +E+P +G + Q EV+ + + Sbjct 242 LRTPLSAAERVKVEYGSLNKHQDSGGDLIELPIIGD---ETSTHQVSLEVV---HNVIYA 295 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVF-HTQVRIGAPLNIT 365 V E ++ L + L + +K HL AG+VLTGG +++G+ A +F H VRI PL I Sbjct 296 RVEETLMILAKSLEKSMLKEHLGAGVVLTGGMVKLDGIRELAGAIFSHMPVRIARPLEID 355 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRV 401 GL + ++P Y+TA+GL+ YG N E + EK++ Sbjct 356 GLFENLRDPSYATAIGLILYGAGRFTNYEIDSEKKI 391 >gi|56707352|ref|YP_169248.1| Gene info cell division protein FtsA [Francisella tularensis subsp. tularensis SCHU S4] gi|56603844|emb|CAG44820.1| Gene info cell division protein FtsA [Francisella tularensis subsp. tularensis SCHU S4] Length=420 Score = 225 bits (574), Expect = 3e-57, Method: Composition-based stats. Identities = 122/392 (31%), Positives = 223/392 (56%), Gaps = 9/392 (2%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 +++G+ K+ +G++ + + I+GV S+G+ +G V +LE ++ + A+D+A+ + Sbjct 10 AVDLGSHKITVAIGQLAENNSIKILGVSQKQSKGIKQGSVINLEIAMETLNAALDEAKSI 69 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVI 131 A + V L +S IS N G+ + EV+ ED+ + TAK+V + + +LHV+ Sbjct 70 AGVDVKEVTLGVSAPSISGFNSYGLAAVENGEVSIEDLAMAIKTAKAVPMSADTEMLHVL 129 Query 132 PQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLA 191 ++Y +D Q G+ P+G+ VR+++ VH+I + + +N+ K V CG + L+ LA Sbjct 130 QRDYIVDGQAGVTEPIGMFAVRLESNVHIIVASSRLLQNVRKCVSNCGYSISNLVVEHLA 189 Query 192 SSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPP 251 +S + LT++E+E+GVC+V+IG + +V+ G + +T I G ++SDI+ F P Sbjct 190 ASSATLTDNEKEMGVCLVNIGADSTSFSVFADGGICYTSSIKTGGASISSDISKVFRLPI 249 Query 252 SDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNE 310 AE++K+++G A + DE +++P+ G + + Q L+ VIE R E+ Sbjct 250 EAAESLKLQYGYAASKYLKNPDEKIDIPNSLGNAKKRISLQDLSLVIEARVEEIFE---- 305 Query 311 EILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDY 370 L +L Q + +++GIV TGG A+++GLA A+ +F VR+G P+ ++G + Sbjct 306 ---SLYRELDQHRLLEVISSGIVFTGGGAKLKGLARLAEDMFKLPVRVGGPIEVSGANEV 362 Query 371 AQEPYYSTAVGLLHYGKE-SHLNGEAEVEKRV 401 P Y+T VGLL Y E S + + ++E+ V Sbjct 363 VHNPSYATVVGLLKYAAENSDTSNQQKIEEDV 394 >gi|89257156|ref|YP_514518.1| cell division protein FtsA [Francisella tularensis subsp. holarctica] gi|89144987|emb|CAJ80347.1| cell division protein FtsA [Francisella tularensis subsp. holarctica] Length=420 Score = 225 bits (574), Expect = 3e-57, Method: Composition-based stats. Identities = 122/392 (31%), Positives = 223/392 (56%), Gaps = 9/392 (2%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 +++G+ K+ +G++ + + I+GV S+G+ +G V +LE ++ + A+D+A+ + Sbjct 10 AVDLGSHKITVAIGQLAENNSIKILGVSQKQSKGIKQGSVINLEIAMETLNAALDEAKSI 69 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVI 131 A + V L +S IS N G+ + EV+ ED+ + TAK+V + + +LHV+ Sbjct 70 AGVDVKEVTLGVSAPSISGFNSYGLAAVENGEVSIEDLAMAIKTAKAVPMSADTEMLHVL 129 Query 132 PQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLA 191 ++Y +D Q G+ P+G+ VR+++ VH+I + + +N+ K V CG + L+ LA Sbjct 130 QRDYIVDGQAGVTEPIGMFAVRLESNVHIIVASSRLLQNVRKCVSNCGYSISNLVVEHLA 189 Query 192 SSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPP 251 +S + LT++E+E+GVC+V+IG + +V+ G + +T I G ++SDI+ F P Sbjct 190 ASSATLTDNEKEMGVCLVNIGADSTSFSVFADGGICYTSSIKTGGASISSDISKVFRLPI 249 Query 252 SDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNE 310 AE++K+++G A + DE +++P+ G + + Q L+ VIE R E+ Sbjct 250 EAAESLKLQYGYAASKYLKNPDEKIDIPNSLGNAKKRISLQDLSLVIEARVEEIFE---- 305 Query 311 EILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDY 370 L +L Q + +++GIV TGG A+++GLA A+ +F VR+G P+ ++G + Sbjct 306 ---SLYRELDQHRLLEVISSGIVFTGGGAKLKGLARLAEDMFKLPVRVGGPIEVSGANEV 362 Query 371 AQEPYYSTAVGLLHYGKE-SHLNGEAEVEKRV 401 P Y+T VGLL Y E S + + ++E+ V Sbjct 363 VHNPSYATVVGLLKYAAENSDTSNQQKIEEDV 394 >gi|88999609|emb|CAJ75587.1| FTSA protein [Geobacillus thermoleovorans] Length=443 Score = 224 bits (570), Expect = 6e-57, Method: Composition-based stats. Identities = 132/397 (33%), Positives = 225/397 (56%), Gaps = 21/397 (5%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 K + ++VV L++GT+ V ++GE+L +NIIGVG+ + G+ KG + D++ V+ ++ Sbjct 21 KMSSNEIVVSLDVGTSSVKVIIGEMLGSS-INIIGVGNVKAEGLKKGAIVDIDKTVQSIR 79 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVR 120 RA++QAE M I V + ++G HI + G+V ++ E E++ EDV V+ A+ V Sbjct 80 RAVEQAERMVGLSIRRVIVGVAGSHIQLHDCHGIVAVASENREISDEDVARVIDAAQVVS 139 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++ V+P+++ +D +GI +P G+ GVR++ + ++T + N+++ VER GL Sbjct 140 IPPDREIIGVVPRQFIVDGLDGIHDPRGMLGVRLEMEGTMVTGAKTVLHNLLRCVERAGL 199 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++ + LA+ VL++DER LG +VD+GGG+ +AV+ G L+ +P G +T Sbjct 200 EISDICLQPLAAGSLVLSDDERHLGAALVDLGGGSTTVAVFEQGTLQAVSSLPVGGEHIT 259 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 D+A T DAE IK++HG A ++E VP +G + + +A++IE R Sbjct 260 KDLAIGLRTTTDDAEKIKLKHGHAFYDYASEEEVFSVPIMGTDQHQQFSQLEIADIIEAR 319 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+L +V +E+ R+ G + L G VLTGG A + GL A V T VRI Sbjct 320 LEEILQMVQQEV-------RRLGFR-DLPGGYVLTGGVANMPGLLELAHVVLGTSVRIAM 371 Query 361 PLNITGLTDY--AQEPYYSTAVGLLHYG-KESHLNGE 394 P DY ++P Y+ VGLL + +++ L G+ Sbjct 372 P-------DYIGVRDPQYTIGVGLLKFAYRQAQLQGK 401 >gi|56910362|dbj|BAD64889.1| Gene info cell division initiation protein FtsA [Bacillus clausii KSM-K16] gi|56964119|ref|YP_175850.1| Gene info cell division initiation protein FtsA [Bacillus clausii KSM-K16] Length=430 Score = 224 bits (570), Expect = 6e-57, Method: Composition-based stats. Identities = 133/388 (34%), Positives = 220/388 (56%), Gaps = 19/388 (4%) Query 11 VGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAEL 70 V L+IGT+ V +V EV +G +NI+GVG+ PS G+ KG + D++ VK ++RA+DQAE Sbjct 7 VSLDIGTSSVRVIVAEV-ANGSINILGVGNVPSEGIKKGTIVDIDETVKSIERAVDQAER 65 Query 71 MADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHRVL 128 M I V + ++G H+ G+V +S + E+ EDV V+ A+ V + E ++ Sbjct 66 MVGITIKHVVVGVNGSHVELLPCHGVVAVSSSDREIGVEDVRRVMDAAQVVSIPPEREII 125 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 VIP+++ +D + I +P G+ GVR++ + +IT + N+++ VER GL+V ++ Sbjct 126 DVIPKQFIVDGLDEITDPKGMIGVRLEMEGTMITGAKTVLHNLLRCVERAGLEVAEICLN 185 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 GLA+ +++DE+ LGVCV+DIGGG+ I+V+ G L T V+P G+ +T+D+A Sbjct 186 GLATGTVAVSKDEKSLGVCVIDIGGGSTTISVFEQGTLAATSVLPIGGDHITNDLAVGLR 245 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 +AE IK ++G A DE + +VG L + LA +IEPR E+L L Sbjct 246 LTTEEAERIKCKYGHAFIEEASSDEQFAIQTVGSNEKEMLTQLDLAHIIEPRVEEILELS 305 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +E+++L + H +G VLTGG + G+ + + VR+ P N G+ Sbjct 306 AKELVRLGFR--------HFPSGFVLTGGTVMLPGVLELTKDMLQGNVRVAIP-NYIGV- 355 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAE 396 +EP Y+ ++GL+ + +H NG + Sbjct 356 ---REPKYTVSIGLIQF---AHKNGRVQ 377 >gi|46201828|ref|ZP_00054266.2| COG0849: Actin-like ATPase involved in cell division [Magnetospirillum magnetotacticum MS-1] Length=404 Score = 223 bits (567), Expect = 1e-56, Method: Composition-based stats. Identities = 141/421 (33%), Positives = 214/421 (50%), Gaps = 30/421 (7%) Query 13 LEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMA 72 +++GT KV + ++ DG ++G+G +RGM G V D+E + ++ A++ AE MA Sbjct 1 MDVGTTKVCCFIAKIQDDGSPRMVGIGHQVARGMRNGAVVDMEELETSIRAAVESAEEMA 60 Query 73 DCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIP 132 + Q+ +V + +SG H N V ++ V + D+ ++ ++ + ++H IP Sbjct 61 NDQVRAVAVNISGGHPGSANVKVEVAMNGHAVNEADIRRMLEHGRAHHESPDRELIHAIP 120 Query 133 QEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLAS 192 +Y ID EGIK+P G+ G R+ +H+I +N+ V RC L ++ + + AS Sbjct 121 VDYTIDGNEGIKDPRGMFGDRLGVAIHVIAAGIGPVRNLCTVVNRCHLDIEARVVSPYAS 180 Query 193 SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPS 252 + L EDE+ELGV +D+GGGT IAV+ GG L HT VI G VTSDIA TP Sbjct 181 GLACLVEDEKELGVTCIDMGGGTTSIAVFLGGQLVHTDVIAVGGAYVTSDIARGLSTPVI 240 Query 253 DAEAIKVRHGCALGSIVGKDESVEVPSVG---GRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AE +K +G + S E +VP VG +QR L ++I+PR E LV Sbjct 241 HAERLKTLYGSVIPSANDDREIFKVPLVGEDEDGASNQVQRSMLIQIIQPRLEETFELV- 299 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 + L Q G +VLTGGA+Q++G A V QVR+G P+ + GL + Sbjct 300 ------RSHLEQGGFDKLAGRRVVLTGGASQMQGARDLAGHVLDKQVRLGKPIGLHGLPE 353 Query 370 YAQEPYYSTAVGLLHY----------GKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P +ST GL+ Y GK + +GE + G W RL SWL++ Sbjct 354 ATGGPAFSTCAGLIRYALAHAPAQSRGKRTGKSGEGQ---------GGW-GRLGSWLKRN 403 Query 420 F 420 F Sbjct 404 F 404 >gi|67918625|ref|ZP_00512221.1| Cell division protein FtsA [Chlorobium limicola DSM 245] gi|67783800|gb|EAM43183.1| Cell division protein FtsA [Chlorobium limicola DSM 245] Length=460 Score = 223 bits (567), Expect = 2e-56, Method: Composition-based stats. Identities = 127/389 (32%), Positives = 223/389 (57%), Gaps = 11/389 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R + VGL+IGT KV +V E G +N++G G S G+ + V ++ V ++ AI Sbjct 24 RNIAVGLDIGTTKVCVVVAEKDEIGKLNVLGNGRSNSDGLQRATVVNINKTVAAIKAAIA 83 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VRVRD- 123 AE + +I V + +SG H++C + + +++ + E DV + AK+ ++ D Sbjct 84 DAERESSIRIKGVNVGISGAHVNCIHSNSEISVNQTGIVNESDVRRFLEKAKTNIKYLDI 143 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 +H ++HVIPQE+ +D Q+G+ +P+G++G M+ +++ +NI + +E+ GL V Sbjct 144 DHEIIHVIPQEFIVDDQDGVLDPIGMAGTTMRGSAYIVVGLRTKIRNIKQCIEKAGLDVS 203 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 L F +AS +V+ E E++ GV V+DIGGGT ++A+Y GA+R+++V+ A N VT D+ Sbjct 204 ALTFEPVASGIAVMKESEKKSGVVVIDIGGGTTEVAIYIDGAIRYSEVVKVAANDVTHDV 263 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A+ AE +K+RHG A ++G+DE++ +P + GRP +S + +L +IE R E Sbjct 264 AHGVKALHEVAEELKIRHGYAYSKMLGEDETILIPGIEGRPQKSFPKSSLTMIIEARMME 323 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + LV + I ++ G +L AG ++TGG A + G A+ V VR+G P Sbjct 324 IFELVRDSI-------KRSGYYEYLNAGAIITGGGALMPGTEELARDVLGLDVRLGYPEG 376 Query 364 IT-GLTDYAQEPYYSTAVGLLHYGKESHL 391 ++ G+ P Y+T +GL+ + ++ + Sbjct 377 VSGGIKGSVNNPMYATVMGLVAHSLQNSI 405 >gi|78777491|ref|YP_393806.1| Gene info Cell division protein FtsA [Thiomicrospira denitrificans ATCC 33889] gi|78498031|gb|ABB44571.1| Gene info Cell division protein FtsA [Thiomicrospira denitrificans ATCC 33889] Length=453 Score = 222 bits (565), Expect = 2e-56, Method: Composition-based stats. Identities = 119/399 (29%), Positives = 232/399 (58%), Gaps = 11/399 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 + V+ ++IG+ K+ A++ E+ D ++I G G C ++G+ +G + ++E K ++ A++ Sbjct 3 RTVLAIDIGSTKICAIIAEIGSDKSISITGAGVCKAQGLKRGSITNIELASKSIRTALND 62 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTA-KSVRVRDEHR 126 A+ ++ ++ + +++SG + N G+V I +EV+ +++E V+ + + + +E+ Sbjct 63 AKRVSGTEVKNAIVSISGAYTKSLNSSGIVNIQNKEVSFKEIERVMQASLYNANIPNEYE 122 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH +P + +D Q+ I++P+G++ R++ H++T N+ KAV G++VD ++ Sbjct 123 VLHALPYNFKVDDQDYIEDPLGMNASRLEVDTHIVTTQKSNLNNLRKAVRGAGVEVDNIV 182 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 AG ASS + L DE+ELGV ++D+GG T +I +++G ++R+ + + VTSD++ A Sbjct 183 LAGYASSIATLNSDEKELGVALIDMGGNTSNIVIHSGNSIRYNDFLGVGSSHVTSDLSMA 242 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP + AE++K+ +G L ++ +E+P +G S + EV+ + + Sbjct 243 LHTPLNVAESVKLTYGSLLAP---SNDLIELPIIGN---ESATHEVSLEVV---HNVIYA 293 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT-QVRIGAPLNIT 365 V E ++ L + + G+K + AG+VLTGG +Q+EG+ A F + VR+ P + Sbjct 294 RVEETLMILAQFIENSGLKDKMGAGVVLTGGFSQMEGIRELAIATFGSVPVRLAKPKEMH 353 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 GL D + P YS+A+GL+ Y ++ E +V +RV S Sbjct 354 GLFDNLRSPEYSSAIGLVIYAASAYTLYEIDVNRRVRHS 392 >gi|56379501|dbj|BAD75409.1| Gene info cell division protein (septum formation) [Geobacillus kaustophilus HTA426] gi|56419659|ref|YP_146977.1| Gene info cell division protein (septum formation) [Geobacillus kaustophilus HTA426] Length=422 Score = 222 bits (565), Expect = 3e-56, Method: Composition-based stats. Identities = 131/395 (33%), Positives = 224/395 (56%), Gaps = 21/395 (5%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 + ++VV L++GT+ V ++GE+L +NIIGVG+ + G+ KG + D++ V+ ++RA Sbjct 2 SSNEIVVSLDVGTSSVKVIIGEMLGSS-INIIGVGNVKAEGLKKGAIVDIDKTVQSIRRA 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVR 122 ++QAE M I V + ++G HI + G+V ++ E E++ EDV V+ A+ V + Sbjct 61 VEQAERMVGLSIRRVIVGVAGSHIQLHDCHGIVAVASENREISDEDVARVIDAAQVVSIP 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + ++ V+P+++ +D +GI +P G+ GVR++ + ++T + N+++ VER GL++ Sbjct 121 PDREIIGVVPRQFIVDGLDGIHDPRGMLGVRLEMEGTMVTGAKTVLHNLLRCVERAGLEI 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 + LA+ VL++DER LG +VD+GGG+ +AV+ G L+ +P G +T D Sbjct 181 SDICLQPLAAGSLVLSDDERHLGAALVDLGGGSTTVAVFEQGTLQAVSSLPVGGEHITKD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYT 302 +A T DAE IK++HG A ++E VP +G + + +A++IE R Sbjct 241 LAIGLRTTTDDAEKIKLKHGHAFYDYASEEEVFSVPIMGTDQHQQFSQLEIADIIEARLE 300 Query 303 ELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPL 362 E+L +V +E+ R+ G + L G VLTGG A + GL A V T VRI P Sbjct 301 EILQMVQQEV-------RRLGFR-DLPGGYVLTGGVANMPGLLELAHVVLGTSVRIAMP- 351 Query 363 NITGLTDY--AQEPYYSTAVGLLHYG-KESHLNGE 394 DY ++P Y+ VGLL + +++ L G+ Sbjct 352 ------DYIGVRDPQYTIGVGLLKFAYRQAQLQGK 380 >gi|88713167|ref|ZP_01107251.1| cell division protein FtsA [Flavobacteriales bacterium HTCC2170] gi|88708548|gb|EAR00784.1| cell division protein FtsA [Flavobacteriales bacterium HTCC2170] Length=440 Score = 221 bits (563), Expect = 4e-56, Method: Composition-based stats. Identities = 132/380 (34%), Positives = 220/380 (57%), Gaps = 8/380 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 K VGL+IGT K+ A++G+ G + I+G+G S G+ +G VN++ ++ +Q+A+++ Sbjct 5 KYSVGLDIGTTKIVAIIGKENEYGKIEILGIGRSKSLGVHRGVVNNITQTIQSIQQAVEE 64 Query 68 AELMADCQISSVYLALSGKHI-SCQNEIGMVPISEEEVTQED-VENVVHTAKSVRVRDEH 125 AE+ + +I SV + ++G+HI S Q+ + EEV ED ++ + + + + Sbjct 65 AEVNSGLKIGSVVVGIAGQHIRSLQHSDYITRADAEEVINEDDLDRLCNQVYKLVMLPGE 124 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HV+PQEY +D Q IK P+G+ G R++A H++ KN+ + ++ GL + ++ Sbjct 125 EIIHVLPQEYKVDGQAEIKEPIGMYGGRLEANFHVVVGQVSSIKNVGRCIKSAGLDLGKI 184 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LASS +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ G V+T DI Sbjct 185 TLEPLASSDAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGGVITEDIKE 244 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE +K++ G A +E V +P + GR P+ + + L+++I R E++ Sbjct 245 GCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEII 304 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-LNI 364 V EI + + K L AGIVLTGG +Q++ L + + RIG P ++ Sbjct 305 EQVYVEI----KNYGHEEQKKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNEHL 360 Query 365 TGLTDYA-QEPYYSTAVGLL 383 G TD A P Y+TAVGLL Sbjct 361 AGDTDEAVASPLYATAVGLL 380 >gi|2633899|emb|CAB13401.1| Gene info cell-division protein [Bacillus subtilis subsp. subtilis str. 168] gi|120567|sp|P28264|FTSA_BACSU Cell division protein ftsA gi|16078592|ref|NP_389411.1| Gene info cell-division protein [Bacillus subtilis subsp. subtilis str. 168] gi|142940|gb|AAA22456.1| ftsA Length=440 Score = 221 bits (563), Expect = 4e-56, Method: Composition-based stats. Identities = 135/383 (35%), Positives = 216/383 (56%), Gaps = 16/383 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L++GT+ +VGE+ D + NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDLGTSNTKVIVGEMTGDSL-NIIGVGNVPSEGLKKGSIVDIDETVHSIRKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 DQAE M + + ++G +I+ Q+ G+V +S E E+ EDV V+ A+ V V Sbjct 62 DQAERMVGFPLRKAIVGVNGNYINIQDTNGVVAVSSENKEIQVEDVRRVMAAAQVVSVPH 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D ++ I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPKQFIVDGRDEITDPKKMLGVRLEVEGTLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ + L++DE+ LGV ++DIGGG+ IAV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSAALSKDEKNLGVALIDIGGGSTTIAVFQNGHLTSTRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A +DE EV +G ++ +Q A +IE R E Sbjct 242 SIGLRTSTEEAERVKKQLGHAYYDEASEDEIFEVTVIGTNQKQTFTQQEAANIIEARVEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L +V+EE LR G+ L G VLTGG A + G+ + AQ V VR+ P N Sbjct 302 ILEIVSEE-------LRSMGIT-DLPGGFVLTGGQAAMPGVMSLAQDVLQNNVRVQGP-N 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYG 386 G+ D P Y T VGL+ + Sbjct 353 YIGVRD----PQYMTGVGLIQFA 371 >gi|88806820|ref|ZP_01122336.1| cell division protein FtsA [Robiginitalea biformata HTCC2501] gi|88783154|gb|EAR14327.1| cell division protein FtsA [Robiginitalea biformata HTCC2501] Length=443 Score = 221 bits (563), Expect = 4e-56, Method: Composition-based stats. Identities = 130/382 (34%), Positives = 223/382 (58%), Gaps = 8/382 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + K VGL+IGT K+ A++G+ G + ++G+G S G+ +G VN++ ++ +Q+A+ Sbjct 3 EAKYSVGLDIGTTKIVAIIGKENEYGKIEVLGIGRSKSLGVHRGVVNNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHI-SCQNEIGMVPISEEEVT-QEDVENVVHTAKSVRVRD 123 ++A+ + +I +V + ++G+HI S Q+ + + EEV +ED+E +V+ + + Sbjct 63 EEAQSDSGLKIGAVTVGIAGQHIRSLQHSDYITRANSEEVIGEEDLEKLVNQVYKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQEY +D Q IK P+G+ G R++A H++ KNI + ++ GL ++ Sbjct 123 GEEIIHVLPQEYKVDGQAEIKQPIGMYGGRLEANFHVVVGQISSIKNIGRCIKSAGLDLE 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 NITLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A +E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + + K L AGIVLTGG +Q++ L + + RIG P Sbjct 303 IIEQVYLEI----KNYGHEDQKKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNE 358 Query 363 NITGLTDYA-QEPYYSTAVGLL 383 ++ G +D P Y+TAVGLL Sbjct 359 HLAGDSDTEIASPTYATAVGLL 380 >gi|86132610|ref|ZP_01051203.1| cell division protein FtsA [Cellulophaga sp. MED134] gi|85816852|gb|EAQ38037.1| cell division protein FtsA [Cellulophaga sp. MED134] Length=449 Score = 220 bits (561), Expect = 7e-56, Method: Composition-based stats. Identities = 127/382 (33%), Positives = 216/382 (56%), Gaps = 8/382 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 ++ + VGL+IGT K+ A++G V I+G+G S G+ +G VN++ ++ VQ+A+ Sbjct 3 NQNIAVGLDIGTTKIVAMIGRYNEYNKVEILGIGKSKSLGVHRGVVNNITQTIQSVQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVRVRD 123 +AE ++ +I V + ++G+HI + SEE + +D+E + + + Sbjct 63 QEAEDVSGIKIKDVVVGIAGQHIRSLQHSDYITRNNSEEVIDAQDIEALCDQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQEY +D Q IK P+G+ G R++A H++ +NI + V+ GL +D Sbjct 123 GEEIIHVLPQEYKVDGQSEIKEPIGMYGGRVEANFHVVVGQVASIRNIGRCVKSAGLNLD 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GN++T DI Sbjct 183 RITLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNIITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A +E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + + K L AGIVLTGG +Q++ L + + RIG P Sbjct 303 IVEQVYLEI----KNYGHEEQKKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNE 358 Query 363 NITGLTDY-AQEPYYSTAVGLL 383 ++ G +D P Y+TAVGL+ Sbjct 359 HLAGDSDAETTSPLYATAVGLV 380 >gi|73660190|emb|CAI82797.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] gi|73748474|ref|YP_307713.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] gi|88933477|ref|ZP_01139153.1| Cell division protein FtsA [Dehalococcoides sp. BAV1] gi|88914033|gb|EAR33420.1| Cell division protein FtsA [Dehalococcoides sp. BAV1] Length=400 Score = 220 bits (561), Expect = 8e-56, Method: Composition-based stats. Identities = 123/379 (32%), Positives = 211/379 (55%), Gaps = 17/379 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R+ + +++GT+K+ ++ + +G + I+GVG PSRG+ KG V +L + ++ ++ Sbjct 3 RRQIAAIDVGTSKICTVMADT-ENGDLRILGVGVVPSRGLQKGMVVNLNEAKEAIRESVS 61 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDE 124 AE A ++ S + ++GKHI+ +N G++ I+ + V Q D++ + A S+ + + Sbjct 62 MAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVRQSDLQRAIDIASSITMPQD 121 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +VLH+IP+ Y++D QEG+ NPVG+ G R+ + H+IT ++ +N+ K + G+++D Sbjct 122 RKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITAASNSIENLTKCIRAAGVEIDD 181 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 L+F LAS+ + LT++ERE GV + DIGGGT DIA + G ++ HT V+P AG+ VT D++ Sbjct 182 LVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAFKGNSIYHTSVLPIAGSQVTHDVS 241 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 G P AE IK R+ + VE P L E++ R Sbjct 242 VGLGIPFEMAEDIKQRYSSVIPGECNDANFVESGHTFSYP-------DLCEIVRMR---- 290 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 V E + + +L + +G+V+TGG A + G+A V VR+G P N+ Sbjct 291 ---VEELLRLIILELPSDDYSKMVPSGLVITGGTANLPGIAELGSEVLRLPVRVGTPPNL 347 Query 365 TGLTDYAQEPYYSTAVGLL 383 G++D +P + VG+L Sbjct 348 FGVSDILNDPACTNVVGML 366 >gi|67934906|ref|ZP_00527931.1| Cell division protein FtsA [Chlorobium phaeobacteroides DSM 266] gi|67776098|gb|EAM35759.1| Cell division protein FtsA [Chlorobium phaeobacteroides DSM 266] Length=439 Score = 218 bits (554), Expect = 5e-55, Method: Composition-based stats. Identities = 132/394 (33%), Positives = 226/394 (57%), Gaps = 12/394 (3%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 K + VGL+IGT KV +V E G +N++G G S G+ + V ++ V ++ Sbjct 5 KMLKSNIAVGLDIGTTKVCVVVAEKDEMGKINVLGKGRANSDGLQRATVVNINKTVDAIK 64 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VR 120 A+ AE + +I V + +SG H++C + + I++ + + DV+ + AK+ +R Sbjct 65 AAVADAERESSIRILGVNVGISGAHVNCIHSKSEISINQTGIVNDSDVKRFLEKAKTNIR 124 Query 121 --VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 + +H ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + +E+ Sbjct 125 YLLDIDHEIIHVIPQEFIVDDQEGVLDPIGMAGTTMRGSAYIVVGLRTKIRNIKQCIEKA 184 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 GL V +L F +AS +V+ E E++ GV V+D+GGGT ++A+Y GA+R+++VI AGN Sbjct 185 GLVVSELTFEPVASGLAVMKESEKKSGVVVIDVGGGTTEVAIYFDGAIRYSEVIRIAGND 244 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIE 298 VT D+A+ AEA+K+RHGCA I+ +DE++ + + GRP +S + +L +IE Sbjct 245 VTHDVAHGVKALYEVAEALKIRHGCAYSKILKEDETILIEGIEGRPQKSFPKSSLTMIIE 304 Query 299 PRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRI 358 R E+ LV + I ++ G +L AG ++TGG A + G A V VRI Sbjct 305 ARMIEIFELVRDSI-------KRSGYSEYLNAGAIITGGGALLPGTEALVGDVLGLDVRI 357 Query 359 GAPLNIT-GLTDYAQEPYYSTAVGLLHYGKESHL 391 G P ++ G+ D P Y+T +GL+ + + H+ Sbjct 358 GYPERVSGGIKDAVNNPMYATVMGLVAHAFQHHI 391 >gi|68551365|ref|ZP_00590777.1| Cell division protein FtsA [Pelodictyon phaeoclathratiforme BU-1] gi|68241745|gb|EAN23994.1| Cell division protein FtsA [Pelodictyon phaeoclathratiforme BU-1] Length=409 Score = 218 bits (554), Expect = 5e-55, Method: Composition-based stats. Identities = 128/390 (32%), Positives = 225/390 (57%), Gaps = 11/390 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT KV +V E G +N++G G S G+ + V ++ V ++ A+ A Sbjct 6 IAVGLDIGTTKVCVVVAEKDEIGKLNVLGKGRSNSDGLQRATVVNINKTVAAIRAAVADA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE-DVENVVHTAKS-VRVRD-EH 125 E + +I V + +SG H+ C + + I++ + + DV+ + AK+ +R D +H Sbjct 66 ERESSIRIHGVNVGISGAHVHCIHSNSEISINQTGIVNDSDVKRFLEKAKTNIRYLDIDH 125 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + VE+ GL++ + Sbjct 126 EIIHVIPQEFIVDDQEGLLDPIGMAGTTMRGSAYIVVGLRTKIRNIKQCVEKAGLEISAV 185 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +V+ E E++ GV V+DIGGGT ++A+Y GA+R+++VI A N VT DIA+ Sbjct 186 TFEPVASGMAVMKEREKKSGVVVIDIGGGTTEVAIYIDGAIRYSEVIKVAANDVTHDIAH 245 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AE +K++HGCA + G+DE + + + GR +S+ + +L +IE R E+L Sbjct 246 GVRALYEVAEDLKIKHGCAYSKLSGEDEDLLIEGIEGRTQKSVPKSSLTMIIEARMMEIL 305 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV + + ++ G +L AG ++TGG + + G A VF VRIG P ++ Sbjct 306 ELVRDSV-------QRSGYYEYLNAGAIITGGGSLLPGTEELAHDVFGLDVRIGYPEGVS 358 Query 366 -GLTDYAQEPYYSTAVGLLHYGKESHLNGE 394 G+ P Y+T +GL+ + +++L+ + Sbjct 359 GGIKGSVNNPMYATVMGLVAHAFQNNLSAD 388 >gi|3322667|gb|AAC65373.1| Gene info cell division protein (ftsA) [Treponema pallidum subsp. pallidum str. Nichols] gi|15639380|ref|NP_218829.1| Gene info cell division protein (ftsA) [Treponema pallidum subsp. pallidum str. Nichols] Length=414 Score = 217 bits (553), Expect = 7e-55, Method: Composition-based stats. Identities = 135/403 (33%), Positives = 231/403 (57%), Gaps = 17/403 (4%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 +++VGL+IGT + A+V E L G + ++GVG S+G+ +G V ++E+ V + A++ Sbjct 3 EVIVGLDIGTESIRAVVAERLEGGALQVVGVGVGHSKGLRRGVVVNIENTVVGIHHAVEA 62 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE-----EVTQEDVENVVHTAKSVRVR 122 AE+M+ +++ + L G HI +N G+V ++++ EV Q D++ V+ A +V + Sbjct 63 AEMMSGIEVAHCVVGLGGTHIEGRNLKGVVAVADKGKGHREVDQSDIDRVLEVACAVSLP 122 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + ++LHVIP+ Y++D Q GI +P + GVR++ +VH+IT ++++ V+R L + Sbjct 123 PDRKILHVIPKVYSVDDQHGITDPRNIIGVRLEGEVHMITGSATCMRSVIDCVKRANLHI 182 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMD-IAVYTGGALRHTKVIPYAGNVVTS 241 D L+ GLA+ SVL +DER +G +++IGGGT D IA+Y G + T IP G+ VTS Sbjct 183 DFLMHNGLAAVRSVLNDDERNVGCVLINIGGGTTDVIAMYKGSPVLITS-IPVGGSQVTS 241 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 D+A P AE IK++ GC ++ + SV + S G R P + ++ +AE+IE R Sbjct 242 DLAKVKNLPLETAERIKIKDGCCWIPLLEGEGSVLISSQGNRIPVEISKREIAEIIEARM 301 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT-QVRIGA 360 E+ +V + + ++ Q G + I+L GG AQ+ G A +F T +V +G Sbjct 302 CEVFTIVRDRLSTVET---QSG--RGIIENIILCGGGAQLTGAVELASAIFDTPRVHLGI 356 Query 361 PLNITGLTDYAQEPYYSTAVGLL----HYGKESHLNGEAEVEK 399 P + GL + P ++ +GL+ H + G AE+E+ Sbjct 357 PGTLGGLAGEYRSPEFAVVLGLILEYTHKQGQRAYQGRAEMER 399 >gi|76796244|ref|ZP_00778610.1| Cell division protein FtsA [Thermoanaerobacter ethanolicus ATCC 33223] gi|76588396|gb|EAO64802.1| Cell division protein FtsA [Thermoanaerobacter ethanolicus ATCC 33223] Length=408 Score = 217 bits (553), Expect = 7e-55, Method: Composition-based stats. Identities = 127/380 (33%), Positives = 224/380 (58%), Gaps = 15/380 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+VGL+IGT+KV ++GE +G ++I+G+G P G+ KG + D++ ++++++QA Sbjct 4 LIVGLDIGTSKVCTIIGEGDKNGELHIVGIGYYPCYGVKKGVIVDIDETAYSIKKSVEQA 63 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHR 126 E MA+ +ISSVYL + G + G+V +S E E+T++DV+ V+ AK + + + Sbjct 64 ERMANQKISSVYLKIYGGLTTIYKNNGVVAVSREDREITKQDVDRVLQAAKIIAIPSDKE 123 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++ VIP EY +D IK+PVG++G+R++ ++T +N+ K V++ GL+V+ +I Sbjct 124 IIDVIPLEYIVDGYGEIKDPVGMAGIRLEVNAAIVTGSVTAIQNMEKCVKKAGLEVEGII 183 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LA+ +VL +DE+ELGV ++D+G G DI+V+ G+L ++ +I G +T+D++ Sbjct 184 VGPLATGEAVLLKDEKELGVALIDVGAGVTDISVFKYGSLIYSSMIAVGGWHITNDLSIG 243 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 +AE IK ++G K E +++ S+ G+ + ++++IE R +ELL Sbjct 244 LKISFEEAENIKKKYGTLEKLSPEKLEPIKIASLAGKSKSATDVNEISDIIEARVSELLM 303 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ-IEGLAACAQRVFHTQVRIGAPLNIT 365 LV E+L + V + +V+TGG ++G AQ++F+ +RIG+P NI Sbjct 304 LV-------YERLEEAKVLEDIVTNVVITGGGISFLKGNIELAQKIFNRNIRIGSPQNIG 356 Query 366 GLTDYAQEPYYSTAVGLLHY 385 T P YS VG++ Y Sbjct 357 VAT-----PIYSAGVGVVKY 371 >gi|86140620|ref|ZP_01059179.1| cell division protein FtsA [Flavobacterium sp. MED217] gi|85832562|gb|EAQ51011.1| cell division protein FtsA [Flavobacterium sp. MED217] Length=448 Score = 215 bits (547), Expect = 3e-54, Method: Composition-based stats. Identities = 131/403 (32%), Positives = 226/403 (56%), Gaps = 9/403 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + + VGL+IGT K+ A++G + I+G+G S G+ +G VN++ ++ +Q+A+ Sbjct 4 KDIAVGLDIGTTKIVAMIGRYNEYQKLEILGIGKSKSLGVHRGVVNNITQTIQSIQQAVQ 63 Query 67 QAELMADCQISSVYLALSGKHI-SCQNEIGMVPISEEEVT-QEDVENVVHTAKSVRVRDE 124 +AE ++ +I V + ++G+HI S Q+ + ++V +D++ + + + + Sbjct 64 EAESVSGMKIEDVVVGIAGQHIRSLQHSDYITRADADQVIGPKDIDMLCNQVHKLVMLPG 123 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++HV+PQEY +D Q I P+G+ G R++A H++ +NI + V+ GL +D+ Sbjct 124 EEIIHVLPQEYKVDGQAEITQPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLNLDK 183 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 184 ITLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDIK 243 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 AE +K++ G A +E V +P + GR P+ + + L+++I R E+ Sbjct 244 EGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEI 303 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-LN 363 + V EI + + K L AGIVLTGG +Q++ L + + RIG P + Sbjct 304 VEQVYLEI----KNYGHEEQKKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNEH 359 Query 364 ITGLTDY-AQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASV 405 + G +D P Y+TAVGL+ E N E + E + TA V Sbjct 360 LAGDSDSETTSPLYATAVGLVMNSLEHQHNSEDD-EPQDTAVV 401 >gi|89203119|ref|ZP_01181816.1| Cell division protein FtsA [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|89148876|gb|EAR69420.1| Cell division protein FtsA [Bacillus cereus subsp. cytotoxis NVH 391-98] Length=434 Score = 214 bits (546), Expect = 4e-54, Method: Composition-based stats. Identities = 134/396 (33%), Positives = 223/396 (56%), Gaps = 21/396 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDTL-NIIGVGNVKSNGLKKGSIVDIDETVQSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ L+ DE+ GV +VDIGGG+ +A++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVALSSDEKNRGVALVDIGGGSTTLAIFRDGELQATSVLPIGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +AE IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENAEQIKLKYGHAFYDTASEEEVFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 LV EE+ R+ GVK +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MLVQEEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRITTP---- 351 Query 366 GLTDY--AQEPYYSTAVGLLHYG-KESHLNGEAEVE 398 DY +EP Y+ VGL+ Y +++ L G++ E Sbjct 352 ---DYIGVREPQYTIGVGLIKYSYQKAKLRGKSVQE 384 >gi|83856722|ref|ZP_00950251.1| Cell division protein FtsA [Croceibacter atlanticus HTCC2559] gi|83850522|gb|EAP88390.1| Cell division protein FtsA [Croceibacter atlanticus HTCC2559] Length=445 Score = 214 bits (546), Expect = 4e-54, Method: Composition-based stats. Identities = 125/380 (32%), Positives = 214/380 (56%), Gaps = 10/380 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT K+ A++G+ G + I+G+G S G+ +G VN++ ++ +Q+A+D+A Sbjct 6 IAVGLDIGTTKIVAMIGKHNEYGKLEILGIGRSKSLGVHRGVVNNITQTIQSIQQAVDEA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRDEHR 126 + + +I V + ++G+HI + P ++E + +D+E + + + Sbjct 66 QADSGLKIEDVVVGIAGQHIRSLQHSDYITRPNADEVIDSKDIEKLCGQVHKLVMLPGEE 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++HV+PQE+ ID Q +K P+G+ G R++A H++ +NI + V+ GL++ + Sbjct 126 IIHVLPQEFKIDGQAEVKEPIGMYGGRLEANFHVVVGQVASIRNIGRCVKSSGLELSTVT 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 186 LEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDIKEG 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 AE +K++ G A +E V +P + GR P+ + + L+++I R E++ Sbjct 246 CSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEIIE 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 EI + + K L AGIVLTGG AQ++ L + + RIG P N Sbjct 306 QAYLEI----KNYGHEEQKKKLIAGIVLTGGGAQLKHLKQLVEYITGMDTRIGFP-NEHL 360 Query 367 LTDYAQE---PYYSTAVGLL 383 D +E P Y+TAVGL+ Sbjct 361 AHDNEKELTSPQYATAVGLV 380 >gi|32262328|gb|AAP77376.1| Gene info cell division protein FtsA [Helicobacter hepaticus ATCC 51449] gi|32266278|ref|NP_860310.1| Gene info cell division protein FtsA [Helicobacter hepaticus ATCC 51449] Length=456 Score = 214 bits (546), Expect = 4e-54, Method: Composition-based stats. Identities = 115/396 (29%), Positives = 225/396 (56%), Gaps = 9/396 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++++G++IG+ K+ +++ E+ DG I+G G + G+ KG + ++E ++ +++ Sbjct 3 QIILGIDIGSTKICSIIAEIKKDGTPFILGSGIHKADGIKKGSITNIELASLAIRNSVND 62 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTA-KSVRVRDEHR 126 A+ +AD ++ ++LSG + E +V + E+ +++ V+ TA + + + H Sbjct 63 AKRVADEKVDKAIISLSGAYTKSIRESAVVNVPSNEIGLKEINRVMQTAIYNAVIPEGHT 122 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 V+H +P E+ +D Q ++P+G+S R++A VH++T +N+ +AV G++++ ++ Sbjct 123 VIHALPYEFRLDDQSYAEDPMGMSASRLEAFVHIVTAKKSALENLKRAVRESGIEIENIV 182 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 + ASS +VL+ +E+ELGV +D+GG T D+ +Y+G ++R++ + + +T D+A A Sbjct 183 LSAYASSIAVLSNEEKELGVVCIDMGGQTCDLMIYSGYSMRYSDFLSVGSHNITIDLATA 242 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRS-LQRQTLAEVIEPRYTELL 305 T PS AE IK G + S K ++++VP + + + + + V+ R E L Sbjct 243 LNTHPSTAEQIKTECGKLILSDEDKTKAIKVPIMSSDTATTNVNLEIVHAVLSARVEETL 302 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L L + + + G++ L AGI LTGG A ++G+ A +F VRI P+ + Sbjct 303 QL-------LAKSIEKSGLRDKLGAGIALTGGMANLDGMQEFASSIFRKPVRISKPMAMN 355 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRV 401 GL D + + +TA+GL+ +G H N E + EK++ Sbjct 356 GLFDGLKGTHSATAIGLILHGAGQHTNYEMDYEKKI 391 >gi|71481296|ref|ZP_00661003.1| Cell division protein FtsA [Prosthecochloris vibrioformis DSM 265] gi|71283771|gb|EAO15593.1| Cell division protein FtsA [Prosthecochloris vibrioformis DSM 265] Length=430 Score = 213 bits (543), Expect = 1e-53, Method: Composition-based stats. Identities = 136/391 (34%), Positives = 215/391 (54%), Gaps = 13/391 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + +GL+IGT KV +V E G +N++G G S G+ + V +++ V ++ A+ A Sbjct 6 IAIGLDIGTTKVCVVVAERDGRGQLNLLGKGHAESEGLQRATVVNVQRTVDSIRAAVADA 65 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEE-VTQEDVENVVHTAKS-VRVRD-EH 125 E + + V + +SG H+ C + I++ V++ DV + A++ +R D E+ Sbjct 66 EQESSITVGPVNVGISGTHVHCITSDAEISINQTGLVSESDVRRFLQKARANIRYLDMEN 125 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HVIPQ + +D QE + +P+GL+G M+ ++ +NI + VE+ GL+V + Sbjct 126 EIIHVIPQSFTVDDQEDLPDPIGLAGTTMKGSALIVVGQKTKIRNIRECVEKAGLQVGSM 185 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 F +AS +VL + E+ GV V+DIGGGT ++A+Y GAL H+ VI A N VT DIA+ Sbjct 186 TFEPIASGLAVLKDREKRGGVVVIDIGGGTTEVALYLNGALHHSAVIKIAANDVTQDIAH 245 Query 246 AFGTPPSDAEAIKVRHGCA-LGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T AE +K+ HG A LG G DE V V V GRP + +Q+L +IE R E+ Sbjct 246 GVKTLHEVAEEMKLAHGFAYLGEGAGDDELV-VAGVEGRPEKYFSKQSLTLIIEARMMEI 304 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 +V ++ LR+ G+ L AG ++TGG + + G A A RV VRIG P + Sbjct 305 FEMV-------RDVLRESGLYDSLNAGAIITGGGSLLPGTAELASRVLGLDVRIGYPEGV 357 Query 365 T-GLTDYAQEPYYSTAVGLLHYGKESHLNGE 394 + G+ P Y+T +GL E ++GE Sbjct 358 SGGIRGSVDSPVYATVMGLAGRVFEQPISGE 388 >gi|52348006|gb|AAU40640.1| Gene info FtsA [Bacillus licheniformis DSM 13] gi|52785504|ref|YP_091333.1| Gene info FtsA [Bacillus licheniformis ATCC 14580] Length=432 Score = 213 bits (542), Expect = 1e-53, Method: Composition-based stats. Identities = 131/383 (34%), Positives = 218/383 (56%), Gaps = 16/383 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L+IGT+ + +VGE + D +NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDIGTSNIKVIVGE-MSDDSLNIIGVGNVPSEGLKKGSIVDIDETVHSIKKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M ++ + ++G +I Q+ G+V +S E E+ EDV V+ A+ V + Sbjct 62 EQAERMIGFPLTHAIVGVNGNYIHIQDTNGVVAVSSENKEIHVEDVRRVMEAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPRQFIVDGRGDITDPKKMLGVRLEVEGSLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE+ LGV ++DIGGG+ +AV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSVALSKDEKNLGVALIDIGGGSTTVAVFEDGHLLATRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A ++E+ EV +G ++ ++ +A++IE R E Sbjct 242 SIGLRTSTDEAERVKKQFGHAFYEEASEEETFEVAVIGTDQKQTFTQREVADIIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EE LR G+K L G VLTGG A + G+ + AQ V VR+ +P N Sbjct 302 IFLFVAEE-------LRNMGIK-ELPGGFVLTGGQAGMPGVLSLAQDVLQNNVRVASP-N 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYG 386 G+ +EP Y T VGL+ + Sbjct 353 YIGV----REPQYMTGVGLIQFA 371 >gi|52003341|gb|AAU23283.1| Gene info cell-division protein [Bacillus licheniformis ATCC 14580] gi|52080130|ref|YP_078921.1| Gene info cell-division protein [Bacillus licheniformis ATCC 14580] Length=432 Score = 213 bits (541), Expect = 1e-53, Method: Composition-based stats. Identities = 131/383 (34%), Positives = 218/383 (56%), Gaps = 16/383 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L+IGT+ + +VGE + D +NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDIGTSNIKVIVGE-MSDDSLNIIGVGNVPSEGLKKGSIVDIDETVHSIKKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M ++ + ++G +I Q+ G+V +S E E+ EDV V+ A+ V + Sbjct 62 EQAERMIGFPLTHAIVGVNGNYIHIQDTNGVVAVSSENKEIHVEDVRRVMEAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPRQFIVDGRGDITDPKKMLGVRLEVEGSLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE+ LGV ++DIGGG+ +AV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSVALSKDEKNLGVALIDIGGGSTTVAVFEDGHLLATRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A ++E+ EV +G ++ ++ +A++IE R E Sbjct 242 SIGLRTSTDEAERVKKQFGHAFYEEASEEETFEVAVIGTDQKQTFTQREVADIIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EE LR G+K L G VLTGG A + G+ + AQ V VR+ +P N Sbjct 302 IFLFVAEE-------LRNMGIK-ELPGGFVLTGGQAGMPGVLSLAQDVLQNNVRVASP-N 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYG 386 G+ +EP Y T VGL+ + Sbjct 353 YIGV----REPQYMTGVGLIQFA 371 >gi|82947793|dbj|BAE52657.1| Gene info Actin-like ATPase involved in cell division [Magnetospirillum magneticum AMB-1] gi|83312952|ref|YP_423216.1| Gene info Actin-like ATPase involved in cell division [Magnetospirillum magneticum AMB-1] Length=414 Score = 213 bits (541), Expect = 2e-53, Method: Composition-based stats. Identities = 142/423 (33%), Positives = 218/423 (51%), Gaps = 16/423 (3%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 A L+ L++GT KV + ++ DG ++G+G +RGM G V D+E + ++ Sbjct 2 AARNGLIAALDVGTTKVCCFIAKIQDDGSPRMVGIGHQVARGMRNGTVVDMEELETSIRA 61 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A++ AE MA+ Q+ +V + +SG H N V ++ V + D+ ++ ++ Sbjct 62 AVEAAEEMANDQVRAVAINISGGHPGSANVKVEVAMNGHAVNEADIRRMLEHGRAHHESP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + ++H IP +Y ID EGIK+P G+ G R+ +H+I +N+ V RC L ++ Sbjct 122 DRELIHAIPVDYTIDGNEGIKDPRGMFGDRLGVAIHVIAAGIGPVRNLSTVVNRCHLDIE 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + + AS + L EDE+ELGV +D+GGGT IAV+ GG L HT VI G VTSDI Sbjct 182 ARVVSPYASGLACLVEDEKELGVTCIDMGGGTTSIAVFLGGQLVHTDVIAVGGAHVTSDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG---GRPPRSLQRQTLAEVIEPR 300 A TP AE +K +G + S E +VP VG +QR L ++I+PR Sbjct 242 ARGLSTPVVHAERLKTLYGSVIPSASDDREIFKVPLVGEDEDGASNQVQRSMLIQIIQPR 301 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E LV + L Q G +VLTGGA+Q++G A +V QVR+G Sbjct 302 LEETFELV-------RSHLEQSGFDKLAGRRVVLTGGASQMQGARDLAGQVLDKQVRLGK 354 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG---SWIKRLNSWLR 417 P+ + GL + P +ST GL+ Y + ++ A + T + G S RL SWL+ Sbjct 355 PIGLHGLPEATGGPAFSTCAGLIRY---ALVHAPAPSRGKRTGAGGDGASGWGRLGSWLK 411 Query 418 KEF 420 + F Sbjct 412 RNF 414 >gi|25527251|gb|AAN04560.1| FtsA [Bacillus mycoides] Length=433 Score = 211 bits (538), Expect = 4e-53, Method: Composition-based stats. Identities = 131/398 (32%), Positives = 223/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ L+ DER GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVALSSDERNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ +L GVK A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFVQDEVHKL-------GVK-QAASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|20136385|gb|AAM11651.1| cell division protein FtsA [Azospirillum brasilense] Length=420 Score = 211 bits (537), Expect = 5e-53, Method: Composition-based stats. Identities = 137/421 (32%), Positives = 216/421 (51%), Gaps = 14/421 (3%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 +AT ++ L++G+ KV L+ V G V I+G+G + G+ G + D+E+ + Sbjct 11 RATRGGIIAALDVGSTKVCCLIARVEDAGGVRIVGIGHQIATGVRAGAIIDMEAAETSIG 70 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVR 122 A+ AE MA+ I V + +S N VP+S +EVT+ DV + A+S++V Sbjct 71 AAVHAAEQMANETIRDVIVNVSSPISHGFN--AEVPVSGQEVTESDVRRALAHARSLQVG 128 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + ++H IP +A+D GI++P G+ G R+ + H+IT +N+ V RC L + Sbjct 129 PDQALVHAIPVGFALDGSRGIRDPKGMYGERLGVQAHVITSPAGAVRNLQTCVARCHLDI 188 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 + L+ + AS + L +DE E+G +D+GGGT I+V++ G L + I GN VT+D Sbjct 189 EGLVASPYASGLACLVDDEMEMGSACIDMGGGTTTISVFSEGTLVWSDCIRLGGNHVTND 248 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAEVIEP 299 IA TP AE +K HG A+ S + E ++VP VG +L + L +I+P Sbjct 249 IARGLTTPVVHAERMKTLHGSAINSPADEREMIDVPQVGEEERLGANNLPKSYLVRIIQP 308 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R E+ ++ +L G + +VLTGGA+Q+ G+ AQ + QVRIG Sbjct 309 RLEEIFE-------HVRSRLEHSGYAKLVGRRVVLTGGASQLPGMRELAQLILDKQVRIG 361 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ITGL + P YSTA GLL + + E V + + R+ WLR+ Sbjct 362 RPTRITGLNEAQGGPSYSTAAGLLLHAVRN--PAELPVAGHEAGAGTGFFGRVGLWLREN 419 Query 420 F 420 Sbjct 420 L 420 >gi|49330000|gb|AAT60646.1| Gene info cell division protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49478444|ref|YP_037969.1| Gene info cell division protein [Bacillus thuringiensis serovar konkukian str. 97-27] Length=435 Score = 211 bits (536), Expect = 6e-53, Method: Composition-based stats. Identities = 129/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|47504487|gb|AAT33163.1| Gene info cell division protein FtsA [Bacillus anthracis str. 'Ames Ancestor'] gi|49180684|gb|AAT56060.1| Gene info cell division protein FtsA [Bacillus anthracis str. Sterne] gi|49186757|ref|YP_030009.1| Gene info cell division protein FtsA [Bacillus anthracis str. Sterne] gi|30258553|gb|AAP27772.1| Gene info cell division protein FtsA [Bacillus anthracis str. Ames] gi|47529339|ref|YP_020688.1| Gene info cell division protein ftsa [Bacillus anthracis str. 'Ames Ancestor'] gi|30263909|ref|NP_846286.1| Gene info cell division protein FtsA [Bacillus anthracis str. Ames] gi|65321234|ref|ZP_00394193.1| COG0849: Actin-like ATPase involved in cell division [Bacillus anthracis str. A2012] Length=433 Score = 210 bits (535), Expect = 7e-53, Method: Composition-based stats. Identities = 129/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|42783000|ref|NP_980247.1| Gene info cell division protein FtsA [Bacillus cereus ATCC 10987] gi|47557059|gb|EAL15388.1| cell division protein FtsA [Bacillus cereus G9241] gi|47565779|ref|ZP_00236818.1| cell division protein FtsA [Bacillus cereus G9241] gi|42738927|gb|AAS42855.1| Gene info cell division protein FtsA [Bacillus cereus ATCC 10987] Length=435 Score = 210 bits (535), Expect = 8e-53, Method: Composition-based stats. Identities = 129/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|51975050|gb|AAU16600.1| Gene info cell division protein [Bacillus cereus E33L] gi|52141581|ref|YP_085248.1| Gene info cell division protein [Bacillus cereus E33L] Length=435 Score = 210 bits (535), Expect = 8e-53, Method: Composition-based stats. Identities = 128/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 + +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFIQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|75762941|ref|ZP_00742744.1| Cell division protein ftsA [Bacillus thuringiensis serovar israelensis ATCC 35646] gi|74489570|gb|EAO52983.1| Cell division protein ftsA [Bacillus thuringiensis serovar israelensis ATCC 35646] Length=435 Score = 210 bits (534), Expect = 1e-52, Method: Composition-based stats. Identities = 128/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ R+ GVK +A+G VLTGG A + G+ A + H VR+ P Sbjct 304 MFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRVATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|29897552|gb|AAP10828.1| Gene info Cell division protein ftsA [Bacillus cereus ATCC 14579] gi|30021996|ref|NP_833627.1| Gene info Cell division protein ftsA [Bacillus cereus ATCC 14579] Length=435 Score = 210 bits (534), Expect = 1e-52, Method: Composition-based stats. Identities = 128/398 (32%), Positives = 224/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ R+ GVK +A+G VLTGG A + G+ A + H VR+ P Sbjct 304 MFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRVATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y++ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTSGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|25527233|gb|AAN04556.1| FtsA [Bacillus mycoides] Length=433 Score = 209 bits (533), Expect = 1e-52, Method: Composition-based stats. Identities = 129/398 (32%), Positives = 223/398 (56%), Gaps = 21/398 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++ V L+IGT+ V ++GE++ D + NIIGVG+ S G+ KG + D++ V+ +++AI+Q Sbjct 5 EIYVSLDIGTSNVKVIIGEMVNDSL-NIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIEQ 63 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEH 125 AE M I V + ++ + G+V +S E E+ EDV V+ A+ V + E Sbjct 64 AERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPER 123 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ + Sbjct 124 EFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVDI 183 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 LA++ ++ DE+ GV +VDIGGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 184 CLQPLAAATVAISSDEKNRGVALVDIGGGSTTLSIFKDGELQTTSVLPLGGDHITKDIAI 243 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T +A+ IK+++G A ++E VP +G + L+++IE R E+L Sbjct 244 GLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEIL 303 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +E+ +L G+K +A+G VLTGG A + G+ A + H VRI P Sbjct 304 MFVQDEVHKL-------GIK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATP---- 351 Query 366 GLTDY--AQEPYYSTAVGLL-HYGKESHLNGEAEVEKR 400 DY +EP Y+ VGL+ H +++ L G+ EK+ Sbjct 352 ---DYIGVREPQYTIGVGLIKHSYQKAKLRGKNVQEKQ 386 >gi|22777155|dbj|BAC13428.1| Gene info cell-division protein (septum formation) [Oceanobacillus iheyensis HTE831] gi|23098927|ref|NP_692393.1| Gene info cell-division protein [Oceanobacillus iheyensis HTE831] Length=428 Score = 209 bits (532), Expect = 2e-52, Method: Composition-based stats. Identities = 125/385 (32%), Positives = 209/385 (54%), Gaps = 20/385 (5%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +++V L+IGT + ++GEV D + NIIGVG+ S GM KG + D++ V ++ A+ Sbjct 3 NSEVLVSLDIGTTMIKVIIGEVQSDSL-NIIGVGTAKSNGMKKGAIVDIDQTVHSIRNAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M I V + ++G HI Q G+V + E E+ EDV V+ A+ + + Sbjct 62 EQAERMVGMHIERVVVGINGSHIQLQPCHGVVAVQSENREIGDEDVTRVIDGAQVISIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P G+ GVR++ + +ITC + NI+K VER L+V Sbjct 122 EREIIDVIPRQFIVDGLDEITDPRGMIGVRLEMEGTIITCSKTVLHNILKCVERANLEVS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE +G ++DIGGG ++V+ L T VI G+ +T D+ Sbjct 182 DICLQPLAAGTIALSKDEMNMGAALIDIGGGCTTVSVFENDHLVATSVISLGGDNITKDL 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE IK+ +G A +DE+ EV ++G + + +A++IE R E Sbjct 242 SIGLRTSTEEAEDIKMNYGHAFYDDAQEDETFEVSTIGSNQRQVFNQLQIADMIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EI R+ G + L G VLTGG + G AQ +F++ VR+ P Sbjct 302 IYAYVEREI-------RKMGYR-ELPGGYVLTGGTIAMPGSLELAQDLFYSNVRVAIP-- 351 Query 364 ITGLTDY--AQEPYYSTAVGLLHYG 386 DY +EP +++ +G+L + Sbjct 352 -----DYIGVREPQFTSGIGILQFA 371 >gi|83575195|gb|ABC21746.1| Gene info Cell division protein FtsA [Rhodospirillum rubrum ATCC 11170] gi|83592281|ref|YP_426033.1| Gene info Cell division protein FtsA [Rhodospirillum rubrum ATCC 11170] Length=440 Score = 208 bits (529), Expect = 4e-52, Method: Composition-based stats. Identities = 137/417 (32%), Positives = 214/417 (51%), Gaps = 14/417 (3%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+ L++GT K+A + DG + ++GVG SRGM G V +++ V V+ A+D A Sbjct 33 LITALDVGTTKIACFIAREEEDGALRVLGVGHHRSRGMRNGQVANMDEVELSVRAAVDAA 92 Query 69 ELMADCQISSVYLALSGKHI-SCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRV 127 E MA+ +ISSV + +SG S + E+ M I+ EV DV + + + + + Sbjct 93 EQMANERISSVVVNVSGGQPHSTRVEVEM-SIAGHEVRGNDVRRIQAYGRGLHTSADREL 151 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 +H IP YAID EG+ +P G+ G + +HL++ +N+ VERC L ++ + Sbjct 152 VHCIPVSYAIDGTEGVLDPRGMFGQSLGVSIHLVSAAAGPLRNLSTVVERCHLDIEDKVV 211 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 + AS + L EDE+++GV V+D+GGGT IAV+ G + HT++IP G VT+DIA Sbjct 212 SPYASGLACLVEDEKQMGVTVIDLGGGTTSIAVFHEGHVVHTEMIPVGGLHVTNDIAKGL 271 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG---GRPPRSLQRQTLAEVIEPRYTEL 304 TP ++AE +K HG S E + VP VG + R L ++I PR E Sbjct 272 TTPVANAERLKTIHGSCSVSPADTREILRVPLVGEDDEATANEVPRSMLVQIIRPRIEET 331 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 LV + +L G +VLTGG +Q++G+ A+ + QVR G P I Sbjct 332 FELV-------RGRLEASGFDKVGGRLVVLTGGGSQLQGVRELAEVILDRQVRPGRPQRI 384 Query 365 TGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNSWLRKEF 420 GL D P ++T G+L Y + + + + T + G+ + R W + F Sbjct 385 RGLADSTSGPAFATCAGMLRYAVQHQVETPDTDPTADETVATGA-LGRFARWWKDNF 440 >gi|15075191|emb|CAC46748.1| Gene info CELL DIVISION PROTEIN [Sinorhizobium meliloti] gi|3122114|sp|O30994|FTSA_RHIME Cell division protein ftsA gi|2465468|gb|AAC45823.1| cell division protein [Sinorhizobium meliloti] gi|15965922|ref|NP_386275.1| Gene info CELL DIVISION PROTEIN [Sinorhizobium meliloti 1021] Length=442 Score = 206 bits (524), Expect = 1e-51, Method: Composition-based stats. Identities = 129/422 (30%), Positives = 217/422 (51%), Gaps = 21/422 (4%) Query 13 LEIGTAKVAALVGEVLPDG----------MVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 L+IG+ KV ++G + P + +IG+G SRG+ G + DL++V V+ Sbjct 28 LDIGSTKVVCMIGRLTPRAESQILPGRTHSIEVIGIGHQKSRGVKNGVIADLDAVESVVR 87 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVR 122 A+D AE MA I S+ + +S + + + +EV D++ V+ A +R Sbjct 88 LAVDAAERMAGLTIDSLIVNVSAGRLQSDVYTATIDLGGQEVEANDLKKVLAAAGHQSLR 147 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + +LH +P +++D + GI++P+ + G + +H++T KN+ V R L V Sbjct 148 TDRAILHSLPTGFSLDGERGIRDPLAMFGDVLGVDMHVLTAERPALKNLELCVNRAHLSV 207 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 + ++ AS + L +DE ELG +D+GGGT I+V+ G L H + G+ VT+D Sbjct 208 EGMVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGKLVHADAVGLGGHHVTTD 267 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPPRSLQRQTLAEVIEP 299 +A T DAE +KV HG AL + + + + VP +G P + R ++ ++ Sbjct 268 LARGLSTRIEDAERLKVVHGSALPNSADERDIISVPPIGEDDRDQPTHVPRALVSRIVRA 327 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R E L L+ ++++++ G + IVLTGGA+Q+ GL A+R+ VRIG Sbjct 328 RIEETLELI-------RDRIQRSGFSPIVGKRIVLTGGASQLTGLPEAARRILARNVRIG 380 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG-SWIKRLNSWLRK 418 PL ++GL A+ P +STAVGL+ Y + + L A + G S R+ WL++ Sbjct 381 RPLGVSGLPAAAKGPAFSTAVGLMIYPQVADLETHAAGSGMFSTLGGNSRFARMGQWLKE 440 Query 419 EF 420 F Sbjct 441 SF 442 >gi|68562889|ref|ZP_00602119.1| Cell division protein FtsA [Rubrobacter xylanophilus DSM 9941] gi|68510955|gb|EAN34832.1| Cell division protein FtsA [Rubrobacter xylanophilus DSM 9941] Length=401 Score = 205 bits (522), Expect = 2e-51, Method: Composition-based stats. Identities = 144/414 (34%), Positives = 227/414 (54%), Gaps = 23/414 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLPD-GMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 +LV G+++GT K+ AL G V P G V ++ G PSRG+ +G + D E + AID Sbjct 5 RLVYGIDVGTTKIVALAGRVDPRRGWVEVLSRGEAPSRGLRRGMIVDRELAASSIAAAID 64 Query 67 QAELMADCQISSVYLALSGKHISCQN-EIGMVPISEEE-VTQEDVENVVHTAKSVRVRDE 124 E+ V + ++G H+S N E+ ++ +T+ V + A+ V + ++ Sbjct 65 DCEVSG----GRVVVGIAGGHLSSFNTEVTLLNRGRNRTITRRFVRRLEEEARRVDLDED 120 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +VLHV+P+ Y +D EG+KNP+GL+ ++ + H++ +N++ AVE CG++V + Sbjct 121 AQVLHVVPRGYVLDGTEGVKNPLGLAARKVTLRAHVVCGAVSSIQNLLAAVEDCGVRVSR 180 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LAS+ + LTE+ERE GV ++DIGGGT DIAV+ GAL HT VIP G +SD+A Sbjct 181 VVLEPLASAEACLTEEERENGVILMDIGGGTTDIAVFQRGALSHTDVIPLGGQSFSSDLA 240 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 Y P AE +K+R+G L S V + V +GG R +++++E R E+ Sbjct 241 YGLKIPVDRAERLKLRYGTVLSSAV---DPVAAVGLGG---RHYNAHFMSQILECRAREI 294 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L + I R + L AG VLTGG + ++G+ A+ + T+ R P + Sbjct 295 LEYARDSI-------RGARLPTSLPAGAVLTGGGSLLDGMPELAEDILRTRARTARPRRV 347 Query 365 TGLTDYAQEPYYSTAVGLLHY-GKESHLNGEAEVEKRVTASVGSWIKRLNSWLR 417 G Q+P YSTAVGLL+ K H E+E + + S GS ++ + SW R Sbjct 348 RGQVKPIQKPQYSTAVGLLYLAAKNDHAGPESEGARAL--SFGSIVEAVKSWFR 399 >gi|86358444|ref|YP_470336.1| Gene info cell division protein [Rhizobium etli CFN 42] gi|86282546|gb|ABC91609.1| Gene info cell division protein [Rhizobium etli CFN 42] Length=443 Score = 202 bits (514), Expect = 2e-50, Method: Composition-based stats. Identities = 127/428 (29%), Positives = 224/428 (52%), Gaps = 24/428 (5%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IG+ KV ++G + P + IIG+G SRG+ G + DL+++ Sbjct 24 IVSVLDIGSTKVVCMIGRLTPREESQILPGRTHNIEIIGIGHQRSRGIKTGVIADLDALE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 ++ A+D AE MA + S+ + L+ + + + +EV D++ V+ A Sbjct 84 GVIRLAVDAAERMAGLTVESLIVNLTAGRLGSDIYTATIDLGGQEVELNDLKKVLSAACQ 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R + VLH + +++D + GI++P+ + G + +H++T KN+ +V R Sbjct 144 QSLRQDRSVLHSLATGFSLDGERGIRDPLAMYGDALGVDMHVVTAERSALKNLELSVNRA 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ ++ AS + L +DE ELG +D+GGGT I+V+ G L HT + G+ Sbjct 204 HLSVEGIVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGKLVHTDAVGLGGHH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPPRSLQRQTLAE 295 VT+D+A T DAE +KV H AL + + E + +P +G P + R ++ Sbjct 264 VTTDLARGLSTRIEDAERLKVVHASALLNSSDERELISIPPIGEDDRDQPSQVPRALVSR 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E + L+ ++++++ G + +VLTGGA+Q+ GLA A+R+ Sbjct 324 IVSARIEETMELI-------RDRIQRSGFSPIVGKRVVLTGGASQLTGLAEVARRILARN 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG---SWIKRL 412 VRIG P+ ++GL A+ P +STAVGL+ Y + + + A + + S+G S I R+ Sbjct 377 VRIGRPMGVSGLPTAAKGPAFSTAVGLMIYPQVADMETHAS-QSGLLMSLGGNNSRIARM 435 Query 413 NSWLRKEF 420 WL++ F Sbjct 436 GQWLKESF 443 >gi|29343039|gb|AAO80802.1| Gene info cell division protein FtsA [Enterococcus faecalis V583] gi|30179796|sp|O07111|FTSA_ENTFA Cell division protein ftsA gi|29375578|ref|NP_814732.1| Gene info cell division protein FtsA [Enterococcus faecalis V583] Length=440 Score = 202 bits (514), Expect = 2e-50, Method: Composition-based stats. Identities = 127/382 (33%), Positives = 209/382 (54%), Gaps = 16/382 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT V +V E + +G +NIIGVG+ S G+++G V D++ V+ +QRA+ QA Sbjct 6 MYVGLDIGTTSVKVVVAEYI-EGQMNIIGVGNAKSDGLNRGIVVDIDQTVQAIQRAVRQA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHR 126 E A QI SV + L + ++ GM+ +S E E+T EDV NV A E + Sbjct 65 EEKAGIQIKSVNVGLPANLLEVESCQGMIAVSSESKEITDEDVRNVASAALVRSTPPERQ 124 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++ ++PQ++ +D EGIK+P G+ GVRM+ + T + NI K VE+ GL +++L+ Sbjct 125 IVAILPQDFTVDGFEGIKDPRGMLGVRMEMFGVVYTGPKTIIHNIRKCVEKAGLGINELV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LA + ++LT+ E++ G V+D+GGG +V L+ T V G +T DI+ Sbjct 185 ITPLALTETILTDGEKDFGTIVIDMGGGQTTTSVIHDKQLKFTHVNQEGGEFITKDISIV 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T ++AEA+K+ +G A +E V +G P + + L+E+IE R Sbjct 245 LNTSFNNAEALKINYGDAYPERTSANEEFPVDVIGKSEPVRVDERYLSEIIEARV----- 299 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 E+IL+ +++ + L G+VLTGGAA + G+ AQ +F V++ P N G Sbjct 300 ---EQILRKSKEVLDEIDAFELPGGVVLTGGAASMPGIVDLAQEIFEANVKLYVP-NHMG 355 Query 367 LTDYAQEPYYSTAVGLLHYGKE 388 L + P ++ + ++ Y + Sbjct 356 L----RNPVFANVISIVEYSAQ 373 >gi|68196302|gb|EAN10731.1| Cell division protein FtsA [Enterococcus faecium DO] gi|69244711|ref|ZP_00602975.1| Cell division protein FtsA [Enterococcus faecium DO] Length=441 Score = 202 bits (513), Expect = 3e-50, Method: Composition-based stats. Identities = 124/379 (32%), Positives = 204/379 (53%), Gaps = 16/379 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT V +V E + D +NIIGVG+ S G+++G + D++ V+ +QRA+ QA Sbjct 6 MYVGLDIGTTSVKVVVAEYI-DSQMNIIGVGNAKSEGINRGIIVDIDKTVQAIQRAVRQA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHR 126 E A QI V + L + +N GM+ ++ +E+T EDV NV A + E + Sbjct 65 EEKAGIQIKGVSVGLPANMLEVENCQGMIAVNGDSKEITDEDVRNVASAALVRSIPPERQ 124 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++ ++PQ++ +D EGIK+P G+ GVR++ L T + NI K VE GL V++++ Sbjct 125 IVSILPQDFTVDGFEGIKDPRGMIGVRLEMYGLLFTGPKTIIHNIRKCVENAGLIVNEMV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LA + S+L++ E++ G V+D+GGG AV L+ T + G VT DI+ Sbjct 185 ITPLALTESILSDGEKDFGTIVIDMGGGQTTTAVMHDKQLKFTNLDQEGGEFVTKDISIV 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T ++AEA+K+ +G A DE V +G P + + L+E+I R ++ N Sbjct 245 LNTSFNNAEALKINYGDAYPERTSPDEEFPVDVIGQSEPVKVDERYLSEIISARMEQIFN 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 + + Q++ L G+VLTGGAA + G+ AQ +F V++ P N G Sbjct 305 KAKDALDQIEAL--------ELPGGVVLTGGAASLPGVVDLAQEIFGVNVKLYVP-NHMG 355 Query 367 LTDYAQEPYYSTAVGLLHY 385 L + P ++ + ++ Y Sbjct 356 L----RNPVFTNVISIVDY 370 >gi|16414653|emb|CAC97369.1| Gene info ftsA [Listeria innocua] gi|16801205|ref|NP_471473.1| Gene info ftsA [Listeria innocua Clip11262] Length=424 Score = 201 bits (512), Expect = 4e-50, Method: Composition-based stats. Identities = 134/406 (33%), Positives = 219/406 (53%), Gaps = 25/406 (6%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D ++ V L+IGTA V ++ E + D +NIIGVG+ S G+ KG + D++ V+ +++AI Sbjct 3 DSEIYVSLDIGTASVKVIIAE-MADDRLNIIGVGNVESSGIKKGIIIDIDKTVESIKKAI 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M +IS V + + + + G+V + E E+T EDV NV+ A+ V + Sbjct 62 EQAERMVGVEISQVIVGVVSSQVHLEACRGIVAVGSENREITDEDVWNVMDAAQVVPLSP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E +++ IP ++ +D GI +P G+ GVR++ + LIT + N ++ VER GL++ Sbjct 122 EREIINTIPDQFVVDGLTGITDPRGMIGVRLEMEGTLITGSKTILHNTLRCVERAGLEIS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA + L+ED++E G +V+IG GT ++V+ G L +T VIP G+ +T D+ Sbjct 182 DIALQPLAEASISLSEDDKEFGTALVNIGAGTTTVSVFEQGRLTYTGVIPVGGDNITKDL 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T ++A+ +K+ HG A DE + +G + + +A++IE R E Sbjct 242 SLGLNTSTANADRVKLEHGYAFYDDASPDEVFAIDVIGSDQKQHFTQVEVADIIEARMEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + LV EE+ ++ K HL G VLTGG+ I G A + VR+ P Sbjct 302 IFQLVVEELNRVG--------KTHLPGGYVLTGGSMAIPGAIDLAGKTLAAHVRLAIP-- 351 Query 364 ITGLTDY--AQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS 407 DY +EP ++TAVGL+ Y + AE+E R +S S Sbjct 352 -----DYIGVREPSFTTAVGLIKYAYQM-----AELEGRDVSSTAS 387 >gi|2222676|emb|CAA74237.1| ftsA [Enterococcus hirae] gi|3122103|sp|O07672|FTSA_ENTHR Cell division protein ftsA Length=442 Score = 201 bits (512), Expect = 4e-50, Method: Composition-based stats. Identities = 126/379 (33%), Positives = 204/379 (53%), Gaps = 16/379 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT V +V E + D +NIIGVG+ S G+++G + D++ V+ +QRA+ QA Sbjct 6 MYVGLDIGTTSVKVVVAEYI-DSQMNIIGVGNAKSEGINRGIIVDIDKTVQAIQRAVRQA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEHR 126 E A QI V + L + +N GM+ ++ +E+T EDV NV A + E + Sbjct 65 EEKAGIQIKGVSVGLPANLLEVENCQGMIAVNGDSKEITDEDVRNVASAALVRSIPPERQ 124 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 ++ ++PQ++ +D EGIK+P G+ GVR++ L T + NI K VE GL V++L+ Sbjct 125 IVSILPQDFTVDGFEGIKDPRGMIGVRLEMYGLLFTGPKTIVHNIRKCVENAGLVVNELV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LA + ++L++ E++ G V+D+GGG AV L+ T + G VT DI+ Sbjct 185 ITPLALTETILSDGEKDFGTIVIDMGGGQTTTAVMHDKQLKFTSLDQEGGEFVTKDISIV 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T ++AEA+K+ +G A +E V +G P + + L+EVI R ++ N Sbjct 245 LNTSFNNAEALKINYGDAYPERTSANEEFPVDVIGQSEPVKVDERYLSEVISARMEQIFN 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 E + Q++ L GIVLTGGAA + G+ AQ +F V++ P N G Sbjct 305 KAKEALDQIEAL--------ELPGGIVLTGGAASLPGVVDLAQEIFGVNVKLYVP-NQMG 355 Query 367 LTDYAQEPYYSTAVGLLHY 385 L + P ++ + ++ Y Sbjct 356 L----RNPVFTNVISIVDY 370 >gi|49532446|emb|CAG70158.1| Gene info cell division protein [Acinetobacter sp. ADP1] gi|50086470|ref|YP_047980.1| Gene info cell division protein [Acinetobacter sp. ADP1] Length=420 Score = 201 bits (511), Expect = 5e-50, Method: Composition-based stats. Identities = 125/417 (29%), Positives = 227/417 (54%), Gaps = 26/417 (6%) Query 10 VVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAE 69 VV ++IGT KV+ L+G+V + +IG+ + +RGM+KG + L+ V+ ++ A+ +AE Sbjct 8 VVAIDIGTHKVSVLIGKVHAPDNIQVIGMATARNRGMNKGKIVSLDKVISAIKNAVAEAE 67 Query 70 LMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEHRV 127 MA+C++ + ++++ + G +PI++ + +T +V + AK+ V ++ + Sbjct 68 NMAECRVHTAWVSIPTTELQSFYASGRIPIAKADHTITTNEVVRALELAKASHVTPDYYL 127 Query 128 LHVIPQEYAID-YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +P + +D E ++NP+ +S M L+ + +N+ +A++ + V++++ Sbjct 128 ASAVPLGFELDDSSEWVQNPINMSAHSMTGHYQLMMMPISIMQNLDRAMKGASIGVEKMV 187 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 + LA++ + L +DE+E GVC++DIG GT +IAVY G L + + G VT DIA Sbjct 188 VSCLATAEASLLKDEKEYGVCLLDIGAGTTNIAVYLDGRLALARTLQRGGENVTRDIAAV 247 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T +AE IK+ HGC S + D+ ++V ++ G P+++ R LAE+I RY E+L Sbjct 248 LQTTTEEAERIKILHGCVDLSAIKPDQMIQVQAIDG--PQTISRIELAEIIIARYEEILG 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 Q++++L + G H L G+VLTG A QIEG+ + A+R+ +G P Sbjct 306 -------QVRDELERSGAIHGLYHGVVLTGDACQIEGMISLARRILGVSAHLGNP----P 354 Query 367 LTDYAQEPY--------YSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSW 415 L YA + + Y+TA GLL + + + + E+ S+ W + N W Sbjct 355 LQVYADDQHQASIRRSMYATAAGLLMFSQSELQDTVEDSEEASQRSL--WNRVANGW 409 >gi|82700243|ref|YP_414817.1| Gene info Heat shock protein Hsp70:Cell division protein FtsA [Brucella melitensis biovar Abortus 2308] gi|82616344|emb|CAJ11401.1| Gene info Heat shock protein Hsp70:Cell division protein FtsA [Brucella melitensis biovar Abortus] Length=440 Score = 200 bits (508), Expect = 1e-49, Method: Composition-based stats. Identities = 129/428 (30%), Positives = 216/428 (50%), Gaps = 22/428 (5%) Query 8 KLVVGLEIGTAKVAALV--------GEVLPDGM--VNIIGVGSCPSRGMDKGGVNDLESV 57 +L+ L++G++KV+ ++ G +LP + ++G+G SRG+ G + DL++ Sbjct 20 RLLTVLDVGSSKVSCVIARLRPHEGGALLPGRTHRMEVLGIGHQRSRGVKSGVIIDLDAA 79 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + S+ + +S + + V + EV Q D+ V+ Sbjct 80 EQSIRLAVDAAERMAGLTVDSLIVNISAGRLKSETFTASVNLGGHEVEQTDIRRVLAAGA 139 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 + E ++H +P Y +D + GI+ P+G+ G + +H++T +N+ + R Sbjct 140 KQALAAERHLVHSLPVGYTLDGERGIREPLGMLGDSLGVDMHVLTADAAPLRNLELCINR 199 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 C L V+ ++ AS + L DE E+G +D+GGGT I+V++ G H + GN Sbjct 200 CHLSVEAIVATPYASGLAALVGDEAEMGAACIDMGGGTTTISVFSEGKFIHADAVAIGGN 259 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLA 294 VT D+A F T DAE +KV +G AL S + + VP +G P R L Sbjct 260 HVTMDVARGFSTRMEDAERLKVMYGSALPSAADDRDLISVPPIGDDERDVPNQYPRSVLT 319 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E L LV +++L Q G+ H + +VLTGGA+QI G+ A+R+ Sbjct 320 RIIRARVEETLELV-------RDRLNQSGLGHIVGKRVVLTGGASQIPGMPEAARRILAR 372 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA--EVEKRVTASVGSWIKRL 412 VRIG PL I GL + A+ ++ VGLL Y + + + + + G I+R+ Sbjct 373 NVRIGRPLGIAGLPEAAKGAAFAATVGLLIYPQVAGIEERSVKAASSGLMTGTGGRIQRV 432 Query 413 NSWLRKEF 420 WLR+ F Sbjct 433 GQWLRESF 440 >gi|16411503|emb|CAD00111.1| Gene info ftsA [Listeria monocytogenes] gi|16804072|ref|NP_465557.1| Gene info hypothetical protein lmo2033 [Listeria monocytogenes EGD-e] Length=426 Score = 199 bits (507), Expect = 1e-49, Method: Composition-based stats. Identities = 132/403 (32%), Positives = 218/403 (54%), Gaps = 25/403 (6%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D ++ V L+IGTA V ++ E + D +NIIGVG+ S G+ KG + D++ V+ +++AI Sbjct 3 DSEIYVSLDIGTASVKVIIAE-MADDRLNIIGVGNVESSGIKKGIIIDIDKTVESIKKAI 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M +IS V + + + + G+V + E E+T EDV NV+ A+ V + Sbjct 62 EQAERMVGVEISQVIVGVVSSQVHLEACRGIVAVGSENREITDEDVWNVMDAAQVVPLSP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E +++ IP ++ +D GI +P G+ GVR++ + LIT + N ++ VER GL++ Sbjct 122 EREIINTIPDQFVVDGLTGITDPRGMIGVRLEMEGTLITGSKTILHNTLRCVERAGLEIS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA + L+ED++E G +V++G GT ++V+ G L +T VIP G+ +T D+ Sbjct 182 DIALQPLAEASISLSEDDKEFGTALVNVGAGTTTVSVFEQGRLTYTGVIPVGGDNITKDL 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T ++A+ +K+ HG A DE + +G + + +A++IE R E Sbjct 242 SLGLNTSTANADRVKLDHGYAFYDDASPDEVFAIDVIGSDQKQHFTQVEVADIIEARMEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + LV EE+ ++ K HL G VLTGG+ I G A + VR+ P Sbjct 302 IFQLVVEELTRVG--------KTHLPGGYVLTGGSMAIPGAIDLAGKTLAAHVRLAIP-- 351 Query 364 ITGLTDY--AQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 DY +EP ++TAVGL+ Y + AE+E R +S Sbjct 352 -----DYIGVREPSFTTAVGLIKYAYQM-----AELEGRDVSS 384 >gi|46908269|ref|YP_014658.1| Gene info cell division protein FtsA [Listeria monocytogenes str. 4b F2365] gi|46881540|gb|AAT04835.1| Gene info cell division protein FtsA [Listeria monocytogenes str. 4b F2365] Length=426 Score = 199 bits (507), Expect = 1e-49, Method: Composition-based stats. Identities = 132/406 (32%), Positives = 217/406 (53%), Gaps = 25/406 (6%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D ++ V L+IGTA V ++ E + D +NIIGVG+ S G+ KG + D+ V+ +++AI Sbjct 3 DSEIYVSLDIGTASVKVIIAE-MADDRLNIIGVGNVESSGIKKGIIIDIHKTVESIKKAI 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 +QAE M +IS V + + + + G+V + E E+T EDV NV+ A+ V + Sbjct 62 EQAERMVGVEISQVIVGVVSSQVHLEACRGIVAVGSENREITDEDVWNVMDAAQVVPLSP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E +++ IP ++ +D GI +P G+ GVR++ + LIT + N ++ VER GL++ Sbjct 122 EREIINTIPDQFVVDGLTGITDPRGMIGVRLEMEGTLITGSKTILHNTLRCVERAGLEIS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA + L+ED++E G +V++G GT ++V+ G L +T VIP G+ +T D+ Sbjct 182 DIALQPLAEASISLSEDDKEFGTALVNVGAGTTTVSVFEQGRLTYTGVIPVGGDNITKDL 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T ++A+ +K+ HG A DE + +G + + +A++IE R E Sbjct 242 SLGLNTSTANADRVKLDHGYAFYDDASPDEVFAIDVIGSDQKQHFTQVEVADIIEARMEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + LV EE+ ++ K HL G VLTGG+ I G A + VR+ P Sbjct 302 IFQLVVEELTRVG--------KTHLPGGYVLTGGSMAIPGAIDLAGKTLAAHVRLAIP-- 351 Query 364 ITGLTDY--AQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS 407 DY +EP ++TAVGL+ Y + E+E R +S S Sbjct 352 -----DYIGVREPSFTTAVGLIKYAYQM-----VELEGRDVSSSAS 387 >gi|23348273|gb|AAN30339.1| Gene info cell division protein FtsA [Brucella suis 1330] gi|17982505|gb|AAL51765.1| Gene info CELL DIVISION PROTEIN FTSA [Brucella melitensis 16M] gi|62290319|ref|YP_222112.1| Gene info FtsA, cell division protein FtsA [Brucella abortus biovar 1 str. 9-941] gi|62196451|gb|AAX74751.1| Gene info FtsA, cell division protein FtsA [Brucella abortus biovar 1 str. 9-941] gi|17986867|ref|NP_539501.1| Gene info CELL DIVISION PROTEIN FTSA [Brucella melitensis 16M] gi|23502297|ref|NP_698424.1| Gene info cell division protein FtsA [Brucella suis 1330] Length=440 Score = 199 bits (506), Expect = 2e-49, Method: Composition-based stats. Identities = 128/428 (29%), Positives = 216/428 (50%), Gaps = 22/428 (5%) Query 8 KLVVGLEIGTAKVAALV--------GEVLPDGM--VNIIGVGSCPSRGMDKGGVNDLESV 57 +L+ L++G++KV+ ++ G +LP + ++G+G SRG+ G + DL++ Sbjct 20 RLLTVLDVGSSKVSCVIARLRPHEGGALLPGRTHRMEVLGIGHQRSRGVKSGVIIDLDAA 79 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + S+ + +S + + V + EV Q D+ V+ Sbjct 80 EQSIRLAVDAAERMAGLTVDSLIVNISAGRLKSETFTASVNLGGHEVEQTDIRRVLAAGA 139 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 + E ++H +P Y +D + GI+ P+G+ G + +H++T +N+ + R Sbjct 140 KQALAAERHLVHSLPVGYTLDGERGIREPLGMLGDSLGVDMHVLTADAAPLRNLELCINR 199 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 C L V+ ++ AS + L DE E+G +D+GGGT I+V++ G H + GN Sbjct 200 CHLSVEAIVATPYASGLAALVGDEAEMGAACIDMGGGTTTISVFSEGKFIHADAVAIGGN 259 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLA 294 VT D+A F T DAE +KV +G AL S + + VP +G P R L Sbjct 260 HVTMDVARGFSTRMEDAERLKVMYGSALPSAADDRDLISVPPIGDDERDVPNQYPRSVLT 319 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E L LV +++L Q G+ H + +VLTGGA+Q+ G+ A+R+ Sbjct 320 RIIRARVEETLELV-------RDRLNQSGLGHIVGKRVVLTGGASQLPGMPEAARRILAR 372 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA--EVEKRVTASVGSWIKRL 412 VRIG PL I GL + A+ ++ VGLL Y + + + + + G I+R+ Sbjct 373 NVRIGRPLGIAGLPEAAKGAAFAATVGLLIYPQVAGIEERSVKAASSGLMTGTGGRIQRV 432 Query 413 NSWLRKEF 420 WLR+ F Sbjct 433 GQWLRESF 440 >gi|2983169|gb|AAC06770.1| Gene info cell division protein FtsA [Aquifex aeolicus VF5] gi|15605991|ref|NP_213368.1| Gene info cell division protein FtsA [Aquifex aeolicus VF5] Length=416 Score = 199 bits (506), Expect = 2e-49, Method: Composition-based stats. Identities = 127/422 (30%), Positives = 230/422 (54%), Gaps = 20/422 (4%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 K + L+IG+ K ++GE G ++IIG G PSRG+ KG +NDL + RA+ + Sbjct 2 KRLAALDIGSQKTVFVIGERDSYGDIHIIGFGEVPSRGIVKGVINDLSEAKGSILRAMKE 61 Query 68 AELMADCQISSVYLALSGKH-----ISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVR 120 AE MA ++ V +SG + QN + IS + E+ + ++ + H ++ Sbjct 62 AEAMAGLKVREVVYNVSGGTTKNGTVKSQNVKDTISISTKSSEIEESHIQRL-HERCLMK 120 Query 121 VRDE-HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 ++E + +++ P++Y +D +KNP+GL G ++ ++H++ + +N+ KA+ G Sbjct 121 AKEEGYEIVYTAPRKYILDDHTEVKNPLGLVGSKLSVEMHVVKVSTTILRNLEKAIREVG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L +AS+ SVLT DE+E GV ++D+G G D ++YT G T V+P+ G + Sbjct 181 LNPVGRTVNAIASADSVLTHDEKEDGVLLLDMGAGLTDYSLYTEGRPYITGVVPFGGINI 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T D++Y AE++KV HG A S+V ++ V++ G +Q++ +AE+I+ Sbjct 241 TKDLSYMLKIDTETAESVKVNHGVAFESLVDDEDVVKIKPRGEDREIPIQKKQVAEIIQS 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVK-HHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRI 358 R E++ V +EI + +GV + + +GIV+TGG A ++G+ + + VRI Sbjct 301 RVEEIVEKVFKEI-------KARGVPLNQINSGIVVTGGTANLKGIRELIEHMTGLPVRI 353 Query 359 GAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 G P I GL + + P Y+T GLL +++ ++G ++ + ++ G++ K L+ +K Sbjct 354 GLPQGIVGLREKIENPKYATVCGLL---RQAFVSGTIDITESTNSNTGNFFKNLSERFKK 410 Query 419 EF 420 F Sbjct 411 WF 412 >gi|55820800|ref|YP_139242.1| Gene info cell division protein [Streptococcus thermophilus LMG 18311] gi|55736785|gb|AAV60427.1| Gene info cell division protein [Streptococcus thermophilus LMG 18311] gi|62527136|ref|ZP_00388429.1| COG0849: Actin-like ATPase involved in cell division [Streptococcus thermophilus LMD-9] Length=458 Score = 199 bits (506), Expect = 2e-49, Method: Composition-based stats. Identities = 124/376 (32%), Positives = 203/376 (53%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + DG +N+IGV + S G+ G + D+++ K ++ AI+QAE Sbjct 9 GLDIGTSSIKVLVAEFI-DGSMNVIGVSNVKSSGVKDGIIVDIDAAAKSIKTAIEQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I V + L + + GM+P+S E E+ EDVE+VV +A + + E V+ Sbjct 68 AGIVIEQVNVGLPANLLQIEPTQGMIPVSSESKEIKDEDVESVVRSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 ++P+E+ +D +GI +P G+ G+R++ + + T + NI K VER G++V+ ++ + Sbjct 128 LVPEEFIVDGFQGIHDPRGMMGIRLEMRGLIYTGPTTILHNIRKTVERAGIQVENIVISP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + +VL E ERE G V+D+GGG +A L+ T + P G +T DI+ T Sbjct 188 LAMTRAVLNEGEREFGATVIDMGGGQTTVATMRAQELQFTNIYPEGGEYITKDISKVLKT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A + E+V+V VG P + + LAE+I R +L+ V Sbjct 248 SMQIAEALKFNFGNADIEEASETETVQVEVVGENSPVEITEKYLAEIISARVKHILDRVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ +G L GIVL GG A + G+ AQ +F T V++ P N G+ Sbjct 308 QDL--------TRGRLLDLPGGIVLVGGTAIMPGVVEVAQEIFETNVKLYIP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + L+ Y Sbjct 357 --RNPMFANVISLVEY 370 >gi|55738686|gb|AAV62327.1| Gene info cell division protein [Streptococcus thermophilus CNRZ1066] gi|55822701|ref|YP_141142.1| Gene info cell division protein [Streptococcus thermophilus CNRZ1066] Length=458 Score = 199 bits (505), Expect = 2e-49, Method: Composition-based stats. Identities = 124/376 (32%), Positives = 203/376 (53%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + DG +N+IGV + S G+ G + D+++ K ++ AI+QAE Sbjct 9 GLDIGTSSIKVLVAEFI-DGSMNVIGVSNVKSSGVKDGIIVDIDAAAKSIKTAIEQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I V + L + + GM+P+S E E+ EDVE+VV +A + + E V+ Sbjct 68 AGIVIEQVNVGLPANLLQIEPTQGMIPVSSESKEIKDEDVESVVSSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 ++P+E+ +D +GI +P G+ G+R++ + + T + NI K VER G++V+ ++ + Sbjct 128 LVPEEFIVDGFQGIHDPRGMMGIRLEMRGLIYTGPTTILHNIRKTVERAGIQVENIVISP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + +VL E ERE G V+D+GGG +A L+ T + P G +T DI+ T Sbjct 188 LAMTRAVLNEGEREFGATVIDMGGGQTTVATMRAQELQFTNIYPEGGEYITKDISKVLKT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A + E+V+V VG P + + LAE+I R +L+ V Sbjct 248 SMQIAEALKFNFGNADIEEASETETVQVEVVGENSPVEITEKYLAEIISARVKHILDRVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ +G L GIVL GG A + G+ AQ +F T V++ P N G+ Sbjct 308 QDL--------TRGRLLDLPGGIVLVGGTAIMPGVVEVAQEIFETNVKLYIP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + L+ Y Sbjct 357 --RNPMFANVISLVEY 370 >gi|17740547|gb|AAL43078.1| Gene info cell division protein [Agrobacterium tumefaciens str. C58] gi|15157219|gb|AAK87837.1| Gene info AGR_C_3785p [Agrobacterium tumefaciens str. C58] gi|2465464|gb|AAC45820.1| cell division protein [Agrobacterium tumefaciens] gi|61224300|sp|P0A332|FTSA_AGRTU Cell division protein ftsA gi|61224298|sp|P0A331|FTSA_AGRT5 Gene info Cell division protein ftsA gi|17935972|ref|NP_532762.1| Gene info cell division protein [Agrobacterium tumefaciens str. C58] gi|15889371|ref|NP_355052.1| Gene info hypothetical protein AGR_C_3785 [Agrobacterium tumefaciens str. C58] Length=443 Score = 197 bits (502), Expect = 6e-49, Method: Composition-based stats. Identities = 128/428 (29%), Positives = 222/428 (51%), Gaps = 24/428 (5%) Query 9 LVVGLEIGTAKVAALVG--------EVLPDGM--VNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IG+ KV ++G E+LP V IIG+G SRG+ G + DL+++ Sbjct 24 IVSVLDIGSTKVVCMIGRLTPRQESEILPGRTHKVEIIGIGHQRSRGVKSGVIADLDALE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 ++ ++D AE MA + S+ + +S ++ + + +EV D+ V+ A Sbjct 84 GVIRLSVDAAERMAGLTVDSLIVNVSAGRLASDIYTASIDLGGQEVEASDLRKVLVAASQ 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R + +LH +P Y++D + GI++P+ + G + +H++T KN+ V R Sbjct 144 QSMRQDRAILHSLPTGYSLDGERGIRDPLSMYGDLLGVDMHVVTVERTALKNLELCVNRA 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ ++ AS + L +DE ELG +D+GGGT I+V+ G L HT I G+ Sbjct 204 HLSVEGMVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGRLIHTDAIGLGGHH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPPRSLQRQTLAE 295 VT+D+A T DAE +KV HG AL + + + + +P +G P + R + Sbjct 264 VTTDLARGLSTRIEDAERLKVVHGSALLNGADERDMISIPPIGEDDRDQPSQVSRALVTR 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E L L+ ++++++ G + +VLTGGA+Q+ GL A+R+ Sbjct 324 IVRARIEETLELI-------RDRIQKSGFSPIVGKRVVLTGGASQLTGLPETARRILARN 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSW---IKRL 412 VRIG P+ + GL A+ P +STA GL+ Y + + + A + + + G+ I R+ Sbjct 377 VRIGRPMGVAGLPVAAKGPAFSTACGLMIYPQVADIEIHA-AQGGMFSPFGNGSGRIARV 435 Query 413 NSWLRKEF 420 WL++ F Sbjct 436 GQWLKESF 443 >gi|88939985|ref|ZP_01145428.1| cell division protein FtsA [Acidiphilium cryptum JF-5] gi|88921260|gb|EAR40368.1| cell division protein FtsA [Acidiphilium cryptum JF-5] Length=437 Score = 197 bits (501), Expect = 7e-49, Method: Composition-based stats. Identities = 124/376 (32%), Positives = 196/376 (52%), Gaps = 9/376 (2%) Query 13 LEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMA 72 L+IG+ K++ L+G DG + +G G RG+ GG+ DLE K ++ A+ AE A Sbjct 37 LDIGSTKISCLIGRAESDGRLRALGFGWQRGRGVKSGGIVDLEDAEKAIRAAVGAAEDQA 96 Query 73 DCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIP 132 D ++ SV + LS + PI VT++D+ VV A++ + +H +P Sbjct 97 DMRLKSVTVNLSCGQPESRLFNVQWPIDGRAVTEDDIRRVVREARARAASEGRGTIHALP 156 Query 133 QEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLAS 192 ++ D G+ +P GL + A++H++ K++ +ERC L++ ++ A AS Sbjct 157 LNFSTDETGGVADPRGLYCDTLTAQLHVVDAATTAIKSVTACLERCELEIASMVSAPFAS 216 Query 193 SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPS 252 + L EDERELG V+D+GGGT IAV+ G + HT +P GN VT+D+A T + Sbjct 217 GLATLVEDERELGATVIDMGGGTTTIAVFAEGQMLHTAQLPVGGNHVTNDVARLLSTQVA 276 Query 253 DAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPR--SLQRQTLAEVIEPRYTELLNLVNE 310 AE +K +G S E + VP VG + + R L +I PR E+ LV Sbjct 277 HAERLKTLYGTCQESPDDARELLPVPLVGEAEHQIAKVPRSALVSIIRPRLEEIFELV-- 334 Query 311 EILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDY 370 ++++ G+ A +VLTGGA+Q+ G A ++ QVRIG P+ + GL D Sbjct 335 -----RDRIETSGLGRAAGARVVLTGGASQLVGARELAAQILDRQVRIGKPIGVIGLPDA 389 Query 371 AQEPYYSTAVGLLHYG 386 A P ++T +GLL + Sbjct 390 ATGPNFATMIGLLAFA 405 >gi|74420120|gb|ABA04319.1| Gene info Cell division protein FtsA [Nitrobacter winogradskyi Nb-255] gi|75675250|ref|YP_317671.1| Gene info Cell division protein FtsA [Nitrobacter winogradskyi Nb-255] Length=440 Score = 195 bits (495), Expect = 3e-48, Method: Composition-based stats. Identities = 134/426 (31%), Positives = 206/426 (48%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDG----------MVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P V +IG SRGM G V DL Sbjct 22 LVASLDIGTSKIACMIARLRPSAPNDALRGRTHAVELIGYSQIQSRGMKAGAVTDLAQCE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L +S + Q I VT D+ V T Sbjct 82 QAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSDISRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y++D +GI++P G+ R ++++T +AKN++ AVERC Sbjct 142 HATASGRTVLHALPAGYSLDGVKGIRDPRGMVARRFGVDMNVVTTEATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE +LG VV++G GT IAVY+ G + G+ Sbjct 202 HLTVEAMAASPYVAGLSVLTDDEVDLGAAVVEMGAGTTTIAVYSAGRFIYASGFAIGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PPRSLQRQTLAE 295 VT D+A G +DAE IK +G L E + VP+ G P+ + R T+A Sbjct 262 VTMDLARGLGACIADAERIKTLYGTVLTGGSDVRELMTVPAAGDSDCDAPQVVSRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L A +VL+GGA+Q+ G+ A RV Sbjct 322 IVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGVPELASRVLGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VRIG PL L + A+ +S GLL Y + +HL E ++V + ++ Sbjct 375 VRIGRPLGFGRLPNEAKSASFSVPTGLLVYPQYAHLEHVEPRRTRQVRTGTDGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|85714981|ref|ZP_01045966.1| Cell division protein FtsA [Nitrobacter sp. Nb-311A] gi|85698178|gb|EAQ36050.1| Cell division protein FtsA [Nitrobacter sp. Nb-311A] Length=440 Score = 194 bits (493), Expect = 6e-48, Method: Composition-based stats. Identities = 133/426 (31%), Positives = 206/426 (48%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDG----------MVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P V +IG SRGM G V DL Sbjct 22 LVASLDIGTSKIACMIARLRPSAPNDALRGRTHAVELIGYSQIQSRGMKAGAVTDLAQCE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L +S + Q I VT DV V T Sbjct 82 QAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSDVSRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y++D +GI++P G+ R ++++T +AKN++ AVERC Sbjct 142 HATAPGRTVLHALPVGYSLDGVKGIRDPRGMVARRFGVDMNVVTSEATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE +LG VV++G GT IA+Y+ G H G+ Sbjct 202 HLTVEAMAASPYVAGLSVLTDDEVDLGAAVVEMGAGTTTIAIYSAGRFIHASGFAIGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG---GRPPRSLQRQTLAE 295 VT D+A G +DAE IK +G L E + VP+ G P+ + R T+A Sbjct 262 VTMDLARGLGVCIADAERIKTLYGTVLTGGSDVRELMTVPAAGDSDSDAPQVVSRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L A +VL+GGA+Q+ G+ A R+ Q Sbjct 322 IVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGIPELAGRILGRQ 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 +RIG PL L A+ ++ GLL Y + +HL E ++V + ++ Sbjct 375 IRIGRPLGFGRLPSEAKGASFAVPTGLLVYPQYAHLEHVEPRRTRQVRTGTDGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|56551732|ref|YP_162571.1| Gene info cell division protein [Zymomonas mobilis subsp. mobilis ZM4] gi|56543306|gb|AAV89460.1| Gene info cell division protein [Zymomonas mobilis subsp. mobilis ZM4] Length=420 Score = 194 bits (492), Expect = 7e-48, Method: Composition-based stats. Identities = 131/428 (30%), Positives = 217/428 (50%), Gaps = 16/428 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + L+ L+IG++K++AL+ E D ++ ++G G S G+ +G + D+ES K Sbjct 1 MTPVKEGNLITALDIGSSKISALIVEKRADNVLQVLGSGQRESLGVRRGYLFDMESTEKA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 V+ A++QAE +A I SV+++ S + V ++ + + + +E ++ T + Sbjct 61 VREAVEQAERIAGTNIESVWVSFSAGGLISDLSSTEVALNGQRIEEIHMETLLATGRDAI 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 D H VLH P Y +D +G+K+P+GL R+ +H+I +N+ AV L Sbjct 121 DPDGHMVLHAQPALYTLDGLKGVKSPIGLYADRLGVDIHVIAAEPSPVRNLELAVRSAHL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V ++ A +A+ S L +ERELGV +V++G G +++++ GG L IP + +T Sbjct 181 EVQAIVAAPIAAGMSCLFAEERELGVALVELGAGVTNVSLFAGGLLVGLTSIPMGASDIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP----PRSLQRQTLAEV 296 DIA AFGT SDAE +K +G A S E ++V + P+ + R L V Sbjct 241 DDIAAAFGTRRSDAERLKCFYGSAQSSPRDNHEMIDVAPIANDEDVIDPQRISRAQLIGV 300 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 I R ++ + + L+ G + +VLTGG A+++G+A AQ V V Sbjct 301 IRKRLDHWMD-------HIADALKSLGYNGPVGRQVVLTGGGAELKGIADYAQGVLGRSV 353 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGL-LHYGKESHLNGEAEVEKRVTAS---VGSWIKRL 412 RIG P + GL D P ++T GL LH E R+ + +GS+ KRL Sbjct 354 RIGRPHGLVGLPDAHSGPAFATLTGLVLHAASEPFDLRPLSYNNRIGSQKSFMGSF-KRL 412 Query 413 NSWLRKEF 420 R+E+ Sbjct 413 FQMFRREY 420 >gi|71853845|gb|AAZ51868.1| Gene info cell division protein [Streptococcus pyogenes MGAS5005] gi|50903691|gb|AAT87406.1| Gene info Cell division protein ftsA [Streptococcus pyogenes MGAS10394] gi|13622609|gb|AAK34316.1| Gene info cell division protein [Streptococcus pyogenes M1 GAS] gi|71802946|gb|AAX72299.1| Gene info cell division protein [Streptococcus pyogenes MGAS6180] gi|19748675|gb|AAL98106.1| Gene info cell division protein [Streptococcus pyogenes MGAS8232] gi|21904912|gb|AAM79780.1| Gene info putative cell division protein [Streptococcus pyogenes MGAS315] gi|28810850|dbj|BAC63784.1| Gene info putative cell division protein [Streptococcus pyogenes SSI-1] gi|21910709|ref|NP_664977.1| Gene info putative cell division protein [Streptococcus pyogenes MGAS315] gi|28895601|ref|NP_801951.1| Gene info putative cell division protein [Streptococcus pyogenes SSI-1] gi|19746471|ref|NP_607607.1| Gene info cell division protein [Streptococcus pyogenes MGAS8232] gi|15675421|ref|NP_269595.1| Gene info cell division protein [Streptococcus pyogenes M1 GAS] gi|56808761|ref|ZP_00366478.1| COG0849: Actin-like ATPase involved in cell division [Streptococcus pyogenes M49 591] gi|71903851|ref|YP_280654.1| Gene info cell division protein [Streptococcus pyogenes MGAS6180] gi|71911063|ref|YP_282613.1| Gene info cell division protein [Streptococcus pyogenes MGAS5005] gi|50914617|ref|YP_060589.1| Gene info Cell division protein ftsA [Streptococcus pyogenes MGAS10394] Length=454 Score = 193 bits (491), Expect = 1e-47, Method: Composition-based stats. Identities = 120/376 (31%), Positives = 204/376 (54%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + G +N+IGV + PS G+ G + D+E+ ++ A++QAE Sbjct 9 GLDIGTSSIKVLVAEFI-SGEMNVIGVSNVPSTGVKDGIIIDIEAAATAIKTAVEQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I V + L + + GM+P+ E E+ EDV++VV +A + + E V+ Sbjct 68 AGMTIEKVNVGLPANLLQIEPTQGMIPVPSESKEIKDEDVDSVVKSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 ++P+E+ +D +GI++P G+ G+R++ + + T + + N+ K VER G+KV+ +I + Sbjct 128 LVPEEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPSTILHNLRKTVERAGIKVENIIISP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + ++L E ERE G V+D+GGG +A L++T + G +T DI+ T Sbjct 188 LAMAKTILNEGEREFGATVIDMGGGQTTVASMRAQELQYTNIYAEGGEYITKDISKVLKT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 + AEA+K G A S E+V+V VG P + + L+E+I R +L+ V Sbjct 248 SLAIAEALKFNFGQAEISEASITETVKVDVVGSEEPVEVTERYLSEIISARIRHILDRVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ ++G L GIVL GG A + G+ AQ +F V++ P N G+ Sbjct 308 QDL--------ERGRLLDLPGGIVLIGGGAIMPGVVEIAQEIFGVTVKLHVP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P +S + L+ Y Sbjct 357 --RNPMFSNVISLVEY 370 >gi|71490679|gb|EAO23040.1| Cell division protein FtsA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|71542927|ref|ZP_00664436.1| Cell division protein FtsA [Syntrophomonas wolfei str. Goettingen] Length=410 Score = 193 bits (490), Expect = 1e-47, Method: Composition-based stats. Identities = 114/417 (27%), Positives = 220/417 (52%), Gaps = 14/417 (3%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 +R +VV L++GT+ + A + E+ +NI+GV PS G+ KG + D+ES + + + Sbjct 5 NRNIVVALDVGTSFIKAAMAELSQGQEINILGVSHVPSLGLRKGNIVDIESTARSIDSCL 64 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 + E + I+S L SG + N +V + E+TQ+D + V+ +A ++ + Sbjct 65 NDLERLTGVDIASTLLGFSGSSVYAVNNHAVVAVGNPSYEITQDDRQRVLQSACNIALPP 124 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + ++ + ++Y +D +G+K+P+ + G R++ + +I +N+ ++++R L+ + Sbjct 125 DKTIVQAVERQYIVDGYDGVKDPIAMVGSRLELETTIIVAATAAIQNMHRSMQRINLQTE 184 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++++ L + +VL E+E+GV ++DIGGGT +I+ + G+L +T V+P G +T D+ Sbjct 185 KIVYNPLLVAEAVLLPTEKEMGVVLLDIGGGTTEISFFEAGSLLYTSVLPVGGEYITRDL 244 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A T +A IK R+G A I D V V +V G+ R + ++ +AE+I R E Sbjct 245 AIVLRTSLEEAGRIKERNGVASPDIARNDVIVNVKNVQGKEIRQVSQEVVAEIISARIME 304 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 ++ ++ E L+Q + GIV+TGG A++ GL + + R+G P N Sbjct 305 IVEMIYAE-------LKQFACLDRIPGGIVVTGGEAELTGLVKTIEEYTNIPTRLGIPEN 357 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + G+ P + +G L Y +LN + ++ + A +L+ W ++ F Sbjct 358 LRGIPVDFNRPQNAVILGGLIYSSR-YLNINCDNKRGIAA----LFDQLSRWFKELF 409 >gi|47779267|gb|AAT38535.1| FtsA [Bartonella bacilliformis] gi|83751530|ref|ZP_00947943.1| COG0849: Actin-like ATPase involved in cell division [Bartonella bacilliformis KC583] Length=432 Score = 192 bits (488), Expect = 2e-47, Method: Composition-based stats. Identities = 122/426 (28%), Positives = 205/426 (48%), Gaps = 20/426 (4%) Query 8 KLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESV 57 + + L++G++K+ L+ + P + I+G G S G+ G + D+ + Sbjct 14 RFLTVLDVGSSKIVCLIACLHPLEHARHLYGRTHSIEILGFGMQRSCGIKSGVIMDMVAA 73 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + SV + S + G V + EVT DV + Sbjct 74 ERSIRLAVDAAEKMAGLVVDSVIVNFSSSCLKSSFINGTVCLDGHEVTPYDVRMALADVS 133 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 EH ++H +P YA+D +GI +P+G+ G + VH++T +N+ + R Sbjct 134 RKAFDAEHHIVHTVPAFYALDGNKGIVDPIGMIGKTLGVNVHVVTAETAPLRNLETCINR 193 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 L V+ ++ AS SVL DE LG +D+GGGT ++V++ G HT V+P G+ Sbjct 194 AHLSVEAMVATPFASGLSVLINDEARLGAACIDLGGGTTTLSVFSEGKFVHTDVLPVGGH 253 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG-GRPPRSLQRQTLAEV 296 VT D+A F +AE +K+ +G + V +G G R L + Sbjct 254 HVTLDVARGFSMSIEEAERLKIVYGSTFSMSADDRCMINVLEIGNGHHETEYPRAVLGRI 313 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 I R E+L + ++++L + G H + ++LTGGA+Q+ GL A+ + V Sbjct 314 IRARVEEILEM-------MRDRLNRSGFGHIIGKRVILTGGASQLTGLPEMARNILGRNV 366 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA--EVEKRVTASVGSWIKRLNS 414 RIG PL I+ L +A+ +S+AVGLL Y + + K ++ G + +R+ Sbjct 367 RIGRPLGISRLPSFAKGATFSSAVGLLIYPQLVGFEKKTVQTAVKYLSTGRGKYFQRVGQ 426 Query 415 WLRKEF 420 WLRK F Sbjct 427 WLRKTF 432 >gi|14022286|dbj|BAB48896.1| Gene info cell division protein; FtsA [Mesorhizobium loti MAFF303099] gi|13471544|ref|NP_103110.1| Gene info cell division protein FtsA [Mesorhizobium loti MAFF303099] Length=435 Score = 192 bits (488), Expect = 2e-47, Method: Composition-based stats. Identities = 125/424 (29%), Positives = 216/424 (50%), Gaps = 25/424 (5%) Query 13 LEIGTAKVAALVGEVLP--DGM--------VNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 L++G+ KV +V ++ P DG + +IG+G S+G+ G V DL+ ++ Sbjct 21 LDVGSNKVCCMVAKLKPNDDGKLLRGRSHRIQVIGIGHQKSQGVKSGVVVDLDRAEHAIR 80 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVR 122 ++D AE MA + S+ + ++ + + + + E + D++ V+ ++ Sbjct 81 LSVDAAERMAGLTVDSLIVNMTAGRLKSEAFSATINLGGHEADEADIKRVLGAGAKQALK 140 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 E V+H +P +++D + G+++P G+ G + +H++T +N+ ++ R L V Sbjct 141 AEREVIHSLPVGFSLDAERGVRDPRGMVGDALGVDMHVLTGDAAPMRNLELSINRSHLSV 200 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 ++++ AS + L +DE ELG +D+GGGT I+V++ G H I GN VT D Sbjct 201 ERMVATPYASGLAALVDDELELGAACIDMGGGTTTISVFSEGKFVHGDAIAIGGNHVTLD 260 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG--GRPPRSLQRQTLAEVIEPR 300 +A T AE +KV HG AL + V + +G G P + R + ++ R Sbjct 261 MAKGLSTSLDAAERLKVMHGSALPGSADDRDLVSIQPIGDDGDVPLQIPRSVMTRIVRAR 320 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E L L L+++L + G + + +VLTGGA+Q+ GL A+R+ VRIG Sbjct 321 IDETLEL-------LRDRLNKSGYGNAVGKRVVLTGGASQLAGLPEAARRILGRNVRIGR 373 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 PL + GL + A+ P +S AVGLL Y + ESH + R+T + G + R++ WL Sbjct 374 PLGVAGLPEAAKGPAFSAAVGLLIYPQMASFESH-PAKGISGLRMTGT-GGKLHRMSQWL 431 Query 417 RKEF 420 R F Sbjct 432 RDSF 435 >gi|5834365|gb|AAD53931.1| cell division protein FtsA [Zymomonas mobilis] Length=420 Score = 191 bits (484), Expect = 6e-47, Method: Composition-based stats. Identities = 130/428 (30%), Positives = 216/428 (50%), Gaps = 16/428 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + L+ L+IG++K++AL+ E D ++ ++G G S G+ +G + D+ES K Sbjct 1 MTPVKEGNLITALDIGSSKISALIVEKRADNVLQVLGSGQRESLGVRRGYLFDMESTEKA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 V+ A++QAE +A I SV+++ S + V ++ + + + +E ++ T + Sbjct 61 VREAVEQAERIAGTNIESVWVSFSAGGLISDLSSTEVALNGQRIEEIHMETLLATGRDAI 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 D H VLH P Y +D +G+K+P+GL R+ +H+I + + AV L Sbjct 121 DPDGHMVLHAQPALYTLDGLKGVKSPIGLYADRLGVDIHVIAAEPSPVRYLELAVRSAHL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V ++ A +A+ S L +ERELGV +V++G G +++++ GG L IP + +T Sbjct 181 EVQAIVAAPIAAGMSCLFAEERELGVALVELGAGVTNVSLFAGGLLVGLTSIPMGASDIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP----PRSLQRQTLAEV 296 DIA AFGT SDAE +K +G A S E ++V + P+ + R L V Sbjct 241 DDIAAAFGTRRSDAERLKCFYGSAQSSPRDNHEMIDVAPIANDEDVIDPQRISRAQLIGV 300 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 I R ++ + + L+ G + +VLTGG A+++G+A AQ V V Sbjct 301 IRKRLDHWMD-------HIADALKSLGYNGPVGRQVVLTGGGAELKGIADYAQGVLGRSV 353 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGL-LHYGKESHLNGEAEVEKRVTAS---VGSWIKRL 412 RIG P + GL D P ++T GL LH E R+ + +GS+ KRL Sbjct 354 RIGRPHGLVGLPDAHSGPAFATLTGLVLHAASEPFDLRPLSYNNRIGSQKSFMGSF-KRL 412 Query 413 NSWLRKEF 420 R+E+ Sbjct 413 FQMFRREY 420 >gi|28271635|emb|CAD64541.1| Gene info cell division protein FtsA [Lactobacillus plantarum WCFS1] gi|28378798|ref|NP_785690.1| Gene info cell division protein FtsA [Lactobacillus plantarum WCFS1] Length=448 Score = 190 bits (483), Expect = 9e-47, Method: Composition-based stats. Identities = 124/379 (32%), Positives = 199/379 (52%), Gaps = 16/379 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 + VGL+IGT + +V E + G +N+IGVGS S G+ +G + D++ + ++ A+ QA Sbjct 6 IYVGLDIGTTSIKVIVAERV-KGQMNVIGVGSARSNGLSRGVIVDIDKAAETIRSAVRQA 64 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHR 126 E A +I V + + + GM+ +++E E+ EDV+NV A + E Sbjct 65 EEKASIEIKKVIAGVPANLVKIERCRGMIAVADESKEINNEDVQNVAAAALVQSLPPERE 124 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VL VIP E+ +D +GIK+P G+ GVR++ L T + N KA+E+ GL+++Q++ Sbjct 125 VLDVIPDEFVVDGFDGIKDPRGMVGVRLEMHGTLFTGPKTIIHNTRKALEKAGLQIEQIV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 A LA S VL + E++ G ++D+GGG AV L++T V G +T DI+ Sbjct 185 IAPLALSSLVLNDGEQDFGSIIIDMGGGQTTAAVIHDHQLKYTYVDQEGGQYITKDISVV 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 T +AE +K +G A DE V VG P + Q LAE+IE R ++ + Sbjct 245 LNTSIENAEKLKRDYGYADAQQASDDELFPVDVVGQSTPEQISEQYLAEIIEARLDQIFD 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 V + + +++ L GIVLTGG A + G+ A + F T+VR+ P N G Sbjct 305 KVKQHLDEIRAL--------ELPGGIVLTGGVAALPGITDLAAQRFGTRVRVFTP-NQMG 355 Query 367 LTDYAQEPYYSTAVGLLHY 385 L + P + A+ ++ Y Sbjct 356 L----RHPSFDEALAVIKY 370 >gi|24376927|gb|AAN58293.1| Gene info cell division protein FtsA [Streptococcus mutans UA159] gi|24379032|ref|NP_720987.1| Gene info cell division protein FtsA [Streptococcus mutans UA159] Length=453 Score = 190 bits (482), Expect = 1e-46, Method: Composition-based stats. Identities = 120/376 (31%), Positives = 205/376 (54%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + +G +N+IGV + S G+ G + D+++ + ++ AI +AE Sbjct 9 GLDIGTSSIKVLVAEFI-NGSMNVIGVSNVKSSGVKDGIIIDIDTAAEAIKSAIKEAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A IS V + L + + GM+P+ E E+ EDV++VV +A + + E V+ Sbjct 68 AGMSISKVNVGLPANLLQIEPTQGMIPVPSESKEIKDEDVDSVVRSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 +IP+E+ +D +GI++P G+ G+R++ + + T + + N+ K VER G++V+ +I + Sbjct 128 LIPEEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPSTILHNLRKTVERAGIEVENIIISP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + SVL E ERE G V+D+GGG +A L+ T G+ VT DI+ T Sbjct 188 LALTKSVLNEGEREFGATVIDMGGGQTTVASMRAQELQFTNTYAEGGDYVTKDISKVLKT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A + E+V+V VG R P + + L+E+I R LL+ + Sbjct 248 SHQVAEALKFNFGEANVAEASSTETVQVEVVGERNPVEITERYLSEIISARVRHLLDRIK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ ++G L GIV+ GGAA + G+ AQ +F V++ P N G+ Sbjct 308 QDL--------ERGRLLDLPGGIVIVGGAAIMPGVVEIAQEIFGFNVKLHVP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + ++ Y Sbjct 357 --RNPMFANIISIVEY 370 >gi|27354877|dbj|BAC51862.1| Gene info cell division protein [Bradyrhizobium japonicum USDA 110] gi|27381708|ref|NP_773237.1| Gene info cell division protein [Bradyrhizobium japonicum USDA 110] Length=440 Score = 189 bits (480), Expect = 2e-46, Method: Composition-based stats. Identities = 130/429 (30%), Positives = 208/429 (48%), Gaps = 27/429 (6%) Query 9 LVVGLEIGTAKVAALVGEVLPDG----------MVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P V +IG SRGM G V DL Sbjct 22 LVACLDIGTSKIACMIARLKPSAPSEALRGRTHAVELIGYSQIQSRGMKAGAVVDLGECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L++SG +S Q I VT DV V T Sbjct 82 QAVRQAVGLAEKMAKVRVESVLLSVSGGRLSGQLVEAAADIRGGAVTPADVSRVTSTGMR 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 + VLH +P Y +D +GI++P G+ + ++++TC +A+N++ AVERC Sbjct 142 HATGEGRTVLHALPVGYTLDGVKGIRDPRGMVAHQFGVDMNVVTCDATVARNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 + V+ + + + SVLT+DE +LG VV++G GT +AVY GG H G Sbjct 202 HINVEAMAASPYVAGLSVLTDDEADLGAAVVEMGAGTTTMAVYAGGRFVHAAGFAVGGQH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP--PRSLQRQTLAEV 296 +T D+A +DAE IK +G + E + VP+ G P+ + R T+A + Sbjct 262 ITMDLARGLSATIADAERIKTLYGTVITGGSDSRELMSVPTAGDEQDLPQIVSRATIANI 321 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 ++ R E+ +V +++L+ +VL+GGA+Q+ GL ++ V Sbjct 322 VKHRAEEIFEMV-------RDRLKDSPFASEPNGRVVLSGGASQLTGLVELGTQILGRPV 374 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKR-----VTASVGSWIKR 411 R+G PL L + A+ ++ GLL Y + H + VE R V G + + Sbjct 375 RVGRPLGFGRLPNEAKNAAFAVPAGLLVYPQYVH---QEHVEPRHTRQQVRTGTGGYFGK 431 Query 412 LNSWLRKEF 420 + WLR+ F Sbjct 432 VGRWLREGF 440 >gi|83858910|ref|ZP_00952432.1| FtsA, cell division protein FtsA [Oceanicaulis alexandrii HTCC2633] gi|83853733|gb|EAP91585.1| FtsA, cell division protein FtsA [Oceanicaulis alexandrii HTCC2633] Length=439 Score = 189 bits (480), Expect = 2e-46, Method: Composition-based stats. Identities = 137/427 (32%), Positives = 207/427 (48%), Gaps = 29/427 (6%) Query 12 GLEIGTAKVAALVG---EVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 L+IG +K + E L +IGVG +RG+ G V D+ V ++ A++ A Sbjct 24 ALDIGASKTVCFIAKTEETLAGLRPRVIGVGHQSTRGVRAGQVVDVNLAVDSIRAAVENA 83 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR-- 126 E MA +S VYLA S + + ++ EVT D+ ++ A+++R E R Sbjct 84 ERMAGHTVSEVYLAASAGAPASARISVEMDLAAREVTDRDLRRIL--AEALRRHHEQRRV 141 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH +P + +D G+K+P G+ G + +HL++ D +N++ VERC L V + Sbjct 142 LLHALPLSWRVDGHRGVKDPRGMFGESLGVDLHLVSAAADPLQNLISCVERCQLTVAGVA 201 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 S + L DER+LG ++D+G T +AV+ G+L+H +P G VT+DIA Sbjct 202 ATPYVSGIAALAPDERDLGALLIDMGAHTTTVAVFNEGSLQHVDGVPVGGAHVTNDIARG 261 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQT---LAEVIEPRYTE 303 TP + AE IK HGCAL S +E P V G ++ +Q L +I PR E Sbjct 262 LSTPVNAAERIKALHGCALDSPDDDQIMIETPPVAGSGVVTMNQQPKALLNAIIRPRLEE 321 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + +V +++L G +VLTGGAAQ+ G A A RV QVR+G P + Sbjct 322 VFEMV-------RDRLDAAGAASASGRSVVLTGGAAQLPGAAQLAGRVLGKQVRLGRPDS 374 Query 364 ITGLTDYAQEPYYSTAVGLLH----------YGKESHLNGEAEVEKRVTASVGSWIKRLN 413 + GL D P +S A GLL G G A + +R T G +K + Sbjct 375 LAGLGDAVSGPGFSAAAGLLLRCVQGPSEAISGPPRFDQGPARIRERATGEGG--MKAVW 432 Query 414 SWLRKEF 420 W + F Sbjct 433 RWFAESF 439 >gi|69928979|ref|ZP_00625993.1| Cell division protein FtsA [Nitrobacter hamburgensis X14] gi|69142144|gb|EAN60709.1| Cell division protein FtsA [Nitrobacter hamburgensis X14] Length=440 Score = 189 bits (480), Expect = 2e-46, Method: Composition-based stats. Identities = 130/426 (30%), Positives = 206/426 (48%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLPDG----------MVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P V +IG SRGM G V DL Sbjct 22 LVASLDIGTSKIACMIARLKPSAPNEALRGRTHTVELIGYSQIQSRGMKAGAVVDLAQCE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L +S + Q I VT DV V+ Sbjct 82 QAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSDVSRVISAGMR 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y++D +GI++P G+ R ++++T +AKN++ AVERC Sbjct 142 HATAPGRTVLHALPVGYSLDGVKGIRDPRGMVARRFGVDMNVVTSEATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT DE +LG VV++G GT IA+Y+ G H G+ Sbjct 202 HLTVEAMAASPYVAGLSVLTGDEADLGAAVVEMGAGTTTIAIYSAGRFVHASGFAVGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG---GRPPRSLQRQTLAE 295 VT D+A G +DAE IK +G L + + VP+ G P+ + R T+A Sbjct 262 VTMDLARGLGACIADAERIKTLYGTVLTGGSDVRQLMTVPAAGDSDSDAPQVVSRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L A +VL+GGA+Q+ G+ A+R+ Sbjct 322 IVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGVPELARRILGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VRIG PL L + A+ ++ GLL Y + +HL E +++ + ++ Sbjct 375 VRIGRPLGFGRLPNEAKSASFAVPTGLLVYPQYAHLEHVEPRHTRQLRTGTDGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|78698366|ref|ZP_00862869.1| Cell division protein FtsA [Bradyrhizobium sp. BTAi1] gi|78513896|gb|EAP27204.1| Cell division protein FtsA [Bradyrhizobium sp. BTAi1] Length=439 Score = 189 bits (480), Expect = 2e-46, Method: Composition-based stats. Identities = 133/429 (31%), Positives = 211/429 (49%), Gaps = 27/429 (6%) Query 9 LVVGLEIGTAKVAALVGEVLP----DGM------VNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L++GT+K+A ++ + P D + V +IG SRG+ G V D + Sbjct 21 LVASLDVGTSKIACMIARLRPAPPSDALRGRTHAVELIGYSQIQSRGVKAGAVVDPVACE 80 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L ++G + I VTQ DV V T Sbjct 81 QAVRQAVALAERMAKVRVESVLLPVAGGRVMGHLIEATSDIRGGAVTQADVSRVTSTGMH 140 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 + VLH +P Y +D +GI++P G+ + ++++T +AKN++ VERC Sbjct 141 HATGEGRAVLHALPVGYTLDGVKGIRDPRGMLARQFGVDMNVVTADATVAKNLMLVVERC 200 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE +LG VV++G GT IA Y+GG H G+ Sbjct 201 HLNVEAMAASPYVAGLSVLTDDEADLGAAVVEMGAGTTTIATYSGGRFVHASGFALGGHH 260 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 VT D+A +DAE IK +G L E + VP+ G P+ + R T+A Sbjct 261 VTMDLARGLSACIADAERIKTLYGTVLTGGSDARELMSVPTAGDNERDVPQIVSRATIAN 320 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L+ A +VL+GGA+Q+ GL A R+ Sbjct 321 IVRHRAEEIFEMV-------RDRLKDSPFAAEPKARVVLSGGASQLTGLVELATRILDRP 373 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS----WIKR 411 VR+G PL L + A+ ++ GLL Y + +HL VE R T VG+ + + Sbjct 374 VRVGRPLGFGRLPNEAKNAAFAVPTGLLVYPQYAHLE---HVEPRHTRQVGTGTDGYFGK 430 Query 412 LNSWLRKEF 420 + WLR+ F Sbjct 431 VGRWLREGF 439 >gi|68193729|gb|EAN08381.1| Cell division protein FtsA [Mesorhizobium sp. BNC1] gi|69275289|ref|ZP_00611201.1| Cell division protein FtsA [Mesorhizobium sp. BNC1] Length=437 Score = 188 bits (478), Expect = 3e-46, Method: Composition-based stats. Identities = 123/430 (28%), Positives = 214/430 (49%), Gaps = 26/430 (6%) Query 9 LVVGLEIGTAKVAALVGEVLPD----------GMVNIIGVGSCPSRGMDKGGVNDLESVV 58 ++ L++G++KV+ ++ ++LPD + ++G+G S+G+ G V DL+ Sbjct 16 IITVLDVGSSKVSCIIAKLLPDENMRALPHRTHRIRVVGIGHQKSQGVKSGVVVDLDRAE 75 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + ++ A+D AE MA + S+ + +S I + + + EV D+ V+ Sbjct 76 QAIRLAVDAAERMAGLTVDSLIVNVSAGRIRSETASATINLGGHEVANADIARVLLAGAR 135 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R E V+H + +++D + GI++P G+ G + +H++T +N+ + R Sbjct 136 QALRAEREVVHSLAVGFSLDVERGIRDPRGMMGDALGVDMHVVTADAVPLRNLELCINRA 195 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V++++ AS + L +DE E+G +D+GGGT ++V+ G H IP GN Sbjct 196 HLSVERMVATPYASGLAALVDDEAEMGAACIDMGGGTTTMSVFVDGKFVHADAIPVGGNH 255 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKD-ESVEVPSVGGRP---PRSLQRQTLA 294 VT D+A SDAE +KV G AL D E V + +GG P + R + Sbjct 256 VTMDLARGLSIRLSDAERLKVMQGSALPVTTSDDREMVSIQPIGGDEMDQPLQVPRSVMT 315 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 ++ R E L LV +++L + G + +VLTGGA+Q+ GL A+R+ Sbjct 316 RIVRARVEETLELV-------RDRLNRSGYGALVGRRVVLTGGASQLSGLPEAARRLLGR 368 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGK----ESHLNGEAEVEKRVTASVGSWIK 410 VR+G PL + GL + A+ ++ VGLL Y + ES + + R T + G + + Sbjct 369 NVRLGRPLGVAGLPEAAKGAAFAAPVGLLIYPQVAEFESRAAAKGGLFMRATGTAGRF-Q 427 Query 411 RLNSWLRKEF 420 R+ W R F Sbjct 428 RVGQWFRDSF 437 >gi|77408405|ref|ZP_00785145.1| cell division protein FtsA [Streptococcus agalactiae COH1] gi|77173008|gb|EAO76137.1| cell division protein FtsA [Streptococcus agalactiae COH1] Length=457 Score = 188 bits (477), Expect = 4e-46, Method: Composition-based stats. Identities = 118/376 (31%), Positives = 200/376 (53%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + + M N+IGV + PS G+ G + D+E+ ++ A+ QAE Sbjct 9 GLDIGTSSIKVLVAEFIANEM-NVIGVSNVPSSGVKDGIIIDIEAAATAIKEAVKQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I + + L + + GM+P+ E E+ EDVE+VV +A + + E V+ Sbjct 68 AGITIDKINVGLPANLLQIEPTQGMIPVPNESKEIKDEDVESVVKSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 +IP E+ +D +GI++P G+ G+R++ + + T + N+ K VER G+KV+ ++ A Sbjct 128 LIPLEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPTTILHNLRKTVERAGIKVEHVVIAP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + SVL E ERE G V+D+GGG +A L++T + + VT DI+ T Sbjct 188 LALAKSVLNEGEREFGATVIDMGGGQTTVASMRNQELQYTNIYSEGSDYVTKDISKVLRT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A ++V+V VG P + L+++I R ++L V Sbjct 248 TVEIAEALKFNFGQANVEEASTSDTVQVNVVGNEEPVEITESYLSQIISGRIRQILEHVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ +G L GI+L GG A + G+ AQ++F T+V++ P N G+ Sbjct 308 QDL--------GRGRLLDLPGGIILVGGGAIMPGVVEVAQQIFGTRVKLHVP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + ++ Y Sbjct 357 --RNPMFANVISIVDY 370 >gi|76562339|gb|ABA44923.1| Gene info cell division protein FtsA [Streptococcus agalactiae A909] gi|76787282|ref|YP_329212.1| Gene info cell division protein FtsA [Streptococcus agalactiae A909] gi|77411449|ref|ZP_00787795.1| cell division protein FtsA [Streptococcus agalactiae CJB111] gi|77405600|ref|ZP_00782690.1| cell division protein FtsA [Streptococcus agalactiae H36B] gi|77175822|gb|EAO78601.1| cell division protein FtsA [Streptococcus agalactiae H36B] gi|77162535|gb|EAO73500.1| cell division protein FtsA [Streptococcus agalactiae CJB111] gi|76798296|ref|ZP_00780543.1| Similar to cell division protein FtsA [Streptococcus agalactiae 18RS21] gi|76586368|gb|EAO62879.1| Similar to cell division protein FtsA [Streptococcus agalactiae 18RS21] Length=457 Score = 188 bits (477), Expect = 4e-46, Method: Composition-based stats. Identities = 118/376 (31%), Positives = 200/376 (53%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + + M N+IGV + PS G+ G + D+E+ ++ A+ QAE Sbjct 9 GLDIGTSSIKVLVAEFIANEM-NVIGVSNVPSSGVKDGIIIDIEAAATAIKEAVKQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I + + L + + GM+P+ E E+ EDVE+VV +A + + E V+ Sbjct 68 AGITIDKINVGLPANLLQIEPTQGMIPVPNESKEIKDEDVESVVKSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 +IP E+ +D +GI++P G+ G+R++ + + T + N+ K VER G+KV+ ++ A Sbjct 128 LIPLEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPTTILHNLRKTVERAGIKVEHVVIAP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + SVL E ERE G V+D+GGG +A L++T + + VT DI+ T Sbjct 188 LALAKSVLNEGEREFGATVIDMGGGQTTVASMRNQELQYTNIYSEGSDYVTKDISKVLRT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A ++V+V VG P + L+++I R ++L V Sbjct 248 TVEIAEALKFNFGQANVEEASTSDTVQVNVVGNEEPVEITESYLSQIISGRIRQILEHVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ +G L GI+L GG A + G+ AQ++F T+V++ P N G+ Sbjct 308 QDL--------GRGRLLDLPGGIILVGGGAIMPGVVEVAQQIFGTRVKLHVP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + ++ Y Sbjct 357 --RNPMFANVISIVDY 370 >gi|23094947|emb|CAD46169.1| Gene info ftsA [Streptococcus agalactiae NEM316] gi|25010594|ref|NP_734989.1| Gene info similar to cell division protein FtsA [Streptococcus agalactiae NEM316] gi|77413554|ref|ZP_00789742.1| cell division protein FtsA [Streptococcus agalactiae 515] gi|77160383|gb|EAO71506.1| cell division protein FtsA [Streptococcus agalactiae 515] Length=457 Score = 188 bits (477), Expect = 5e-46, Method: Composition-based stats. Identities = 118/376 (31%), Positives = 200/376 (53%), Gaps = 16/376 (4%) Query 12 GLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELM 71 GL+IGT+ + LV E + + M N+IGV + PS G+ G + D+E+ ++ A+ QAE Sbjct 9 GLDIGTSSIKVLVAEFIANEM-NVIGVSNVPSSGVKDGIIIDIEAAATAIKEAVKQAEEK 67 Query 72 ADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRDEHRVLH 129 A I + + L + + GM+P+ E E+ EDVE+VV +A + + E V+ Sbjct 68 AGITIDKINVGLPANLLQIEPTQGMIPVPNESKEIKDEDVESVVKSALTKSITPEREVIS 127 Query 130 VIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAG 189 +IP E+ +D +GI++P G+ G+R++ + + T + N+ K VER G+KV+ ++ A Sbjct 128 LIPLEFIVDGFQGIRDPRGMMGIRLEMRGLIYTGPTTILHNLRKTVERAGIKVEHVVIAP 187 Query 190 LASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGT 249 LA + SVL E ERE G V+D+GGG +A L++T + + VT DI+ T Sbjct 188 LALAKSVLNEGEREFGATVIDMGGGQTTVASMRNQELQYTNIYSEGSDYVTKDISKVLRT 247 Query 250 PPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVN 309 AEA+K G A ++V+V VG P + L+++I R ++L V Sbjct 248 TVEIAEALKFNFGQANVEEASTSDTVQVNVVGNEEPVEITESYLSQIISGRIRQILEHVK 307 Query 310 EEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTD 369 +++ +G L GI+L GG A + G+ AQ++F T+V++ P N G+ Sbjct 308 QDL--------GRGRLLDLPGGIILVGGGAIMPGVVEVAQQIFGTRVKLHVP-NQVGI-- 356 Query 370 YAQEPYYSTAVGLLHY 385 + P ++ + ++ Y Sbjct 357 --RNPMFANVISIVDY 370 >gi|49239955|emb|CAF26360.1| Gene info Cell division protein ftsA [Bartonella quintana str. Toulouse] gi|49474451|ref|YP_032493.1| Gene info Cell division protein ftsA [Bartonella quintana str. Toulouse] Length=432 Score = 186 bits (471), Expect = 2e-45, Method: Composition-based stats. Identities = 125/431 (29%), Positives = 206/431 (47%), Gaps = 30/431 (6%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVN----------IIGVGSCPSRGMDKGGVNDLESV 57 + + L++G++K+ L+ + P ++ I+G G SRG+ G V D+ + Sbjct 14 RFLTVLDVGSSKIVCLIACLRPLKHIHYLHGRTHSMEILGFGVQRSRGIKSGVVMDMFAA 73 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + SV + S + GMV ++ EVT+ DV + Sbjct 74 EQSIRLAVDAAEKMAGLVVDSVIVNFSSSRLRSAFINGMVRLNGREVTKRDVRMALADVS 133 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 E VLH +P Y +D +GI +P+G++G VH++T +N+ + R Sbjct 134 HKAFDAERHVLHSVPVSYVLDGDKGISDPIGMTGELFGVDVHVVTAETASLRNLEACINR 193 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 L V+ ++ AS +VL DE LG +D GGGT +V++ G H + G Sbjct 194 AHLSVEAMVVTPFASGLAVLMNDEAHLGAACIDFGGGTTTFSVFSEGKFVHADALAVGGY 253 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPR-SLQRQTLAEV 296 VT D+A F ++AE +KV +G AL + + + V +G +P R L + Sbjct 254 HVTLDVARGFSMSITEAERLKVVYGSALLTSADERHMINVTEIGNKPGEIQYPRAVLGRI 313 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 I R E+L +V ++ L + G H + ++LTGGA+Q+ GL A+ + V Sbjct 314 IRARVEEILEMV-------RDCLNRSGFGHIIGKRVILTGGASQLTGLPEMARTILGRNV 366 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG-------SWI 409 RIG PL I+ L A+ +++AVGLL Y + EK V A+V + Sbjct 367 RIGRPLGISRLPSLAKGAAFTSAVGLLIYPQLMGFE-----EKTVQAAVNHLSTGTRGYF 421 Query 410 KRLNSWLRKEF 420 + + WLR+ F Sbjct 422 QCVGQWLRESF 432 >gi|77741184|ref|ZP_00809668.1| Cell division protein FtsA [Rhodopseudomonas palustris BisA53] gi|77698830|gb|EAO89978.1| Cell division protein FtsA [Rhodopseudomonas palustris BisA53] Length=442 Score = 184 bits (468), Expect = 4e-45, Method: Composition-based stats. Identities = 126/426 (29%), Positives = 204/426 (47%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P + +IG SRG+ G V DL Sbjct 24 LVASLDIGTSKIACMIARLTPCPPNNALRGRTHAIELIGYSQIQSRGVKAGAVVDLAECE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V+ A+ AE MA ++ SV L++SG + Q + VTQ DV V Sbjct 84 RAVRHAVALAEGMAKVRVESVLLSVSGGRLQGQLVEASANVHGGAVTQADVARVTSAGMR 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 V+H +P Y ++ +GI++P G+ + ++++T +AKN++ VERC Sbjct 144 HATGQGRTVMHALPVSYTLEGVKGIRDPRGMVARQFGVDMNVVTVDATVAKNLMLVVERC 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE ++G V+++G GT IA Y+ G H G Sbjct 204 HLNVEAMAASPYVAGLSVLTDDEADIGAAVIEMGAGTTTIATYSAGRFVHAGGFAVGGQH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 +T D+A G +DAE IK +G L E + VPS G P+ + R T+A Sbjct 264 ITMDLARGLGACIADAERIKTLYGTVLTGGSDARELLTVPSAGDNERDVPQVISRATIAN 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V ++KL Q A +VL+GGA+Q+ GL A R+ Sbjct 324 IVRHRAEEIFEMV-------RDKLAQSPFAAEPRARVVLSGGASQLTGLPELATRILGRP 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VR+G PL L A+ ++ GLL Y + +HL E ++ + ++ ++ Sbjct 377 VRVGRPLGFGRLPQEAKTASFAVPCGLLVYPQYAHLEHVEPRHSQQPRSGTNGYLGKVGR 436 Query 415 WLRKEF 420 WLR+ F Sbjct 437 WLREGF 442 >gi|39650441|emb|CAE28964.1| Gene info putative cell division protein FtsA [Rhodopseudomonas palustris CGA009] gi|39936585|ref|NP_948861.1| Gene info putative cell division protein FtsA [Rhodopseudomonas palustris CGA009] Length=440 Score = 184 bits (468), Expect = 5e-45, Method: Composition-based stats. Identities = 124/429 (28%), Positives = 211/429 (49%), Gaps = 27/429 (6%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IGT+K+A ++ + P + ++G SRG+ G V D+ Sbjct 22 MVASLDIGTSKIACMIARLKPCPPQEALRGRTHSIELVGYSQIQSRGVKAGAVVDMAECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 K ++ A+ AE MA ++ SV L++S + Q I VT ED+ V T Sbjct 82 KAIRHAVALAERMAKVRVESVLLSVSAGRLQGQLIEATSDIKGGAVTAEDISRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y +D +GI++P G+ + ++++T +AKN++ AVERC Sbjct 142 HATGIGRAVLHALPVGYTLDGVKGIRDPRGMVARQFGVDMNVVTTDATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L+V+ + + + S+LT+DE +LG ++++G GT +A+Y+GG H G+ Sbjct 202 HLEVEAMAASPYVAGLSMLTDDEVDLGAALIEMGAGTTTLAIYSGGRFVHASGFAVGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR--PPRSLQRQTLAEV 296 +T D+A G +DAE IK +G L