Header of the page

BLASTP 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: 1141995580-17322-201268313620.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           3,423,372 sequences; 1,168,150,132 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs


Results of PSI-Blast iteration 2
Skip to the first new sequence

Taxonomy reports
Query= FTSA_ECOLI Length=420

Distribution of 1027 Blast Hits on the Query Sequence




Legend:

New sequence mark - means that the alignment score was below the threshold on the previous iteration

Checked mark - means that the alignment was checked on the previous iteration


Hit list size
Sequences with E-value BETTER than threshold
Related Structures     Score E Sequences producing significant alignments:    (Bits) Value  Checked mark gi|78100129|sp|P0ABH3|FTSA_SHIFL Cell division protein ftsA 602 9e-171  Checked mark gi|24050298|gb|AAN41756.1| ATP-binding cell division protein ... 597 3e-169 Gene info  Checked mark gi|146032|gb|AAA23817.1| FtsA [Escherichia coli] >gi|146025|g... 595 9e-169  Checked mark gi|36786949|emb|CAE16023.1| cell division protein [Photorhabd... 586 6e-166 Gene info  Checked mark gi|85058430|ref|YP_454132.1| cell division protein FtsA [Soda... 583 4e-165 Gene info  Checked mark gi|16418632|gb|AAL19096.1| ATP-binding cell division protein ... 582 1e-164 Gene info  Checked mark gi|45438226|gb|AAS63773.1| cell division protein FtsA [Yersin... 575 1e-162 Gene info  Checked mark gi|46914741|emb|CAG21518.1| putative cell division protein Ft... 570 4e-161 Gene info  Checked mark gi|49613259|emb|CAG76710.1| cell division protein [Erwinia ca... 566 4e-160 Gene info  Checked mark gi|75175651|ref|ZP_00695859.1| COG0849: Actin-like ATPase inv... 562 1e-158  Checked mark gi|89074167|ref|ZP_01160666.1| cell division protein [Photoba... 560 3e-158  Checked mark gi|78701777|ref|ZP_00866224.1| Cell division protein FtsA [Al... 551 2e-155  Checked mark gi|88704104|ref|ZP_01101819.1| Cell division protein FtsA [ga... 551 2e-155  Checked mark gi|74316142|ref|YP_313882.1| Cell division protein FtsA [Thio... 548 1e-154 Gene info  Checked mark gi|88949782|ref|ZP_01152397.1| Cell division protein FtsA [Ha... 548 2e-154  Checked mark gi|9656971|gb|AAF95541.1| cell division protein FtsA [Vibrio ... 548 2e-154 Gene info  Checked mark gi|75853564|ref|ZP_00761381.1| COG0849: Actin-like ATPase inv... 547 3e-154  Checked mark gi|53757202|gb|AAU91493.1| cell division protein FtsA [Methyl... 546 7e-154 Gene info  Checked mark gi|28805446|dbj|BAC58726.1| cell division protein FtsA [Vibri... 546 8e-154 Gene info  Checked mark gi|83648518|ref|YP_436953.1| cell division protein FtsA [Hahe... 545 1e-153 Gene info  Checked mark gi|78368229|ref|ZP_00838470.1| Cell division protein FtsA [Sh... 545 2e-153  Checked mark gi|29540760|gb|AAO89704.1| cell division protein FtsA [Coxiel... 543 4e-153 Gene info  Checked mark gi|77384893|gb|ABA76406.1| Cell division protein FtsA [Pseudo... 543 5e-153 Gene info  Checked mark gi|37197542|dbj|BAC93381.1| cell division protein FtsA [Vibri... 543 6e-153 Gene info  Checked mark gi|67156140|ref|ZP_00417766.1| Cell division protein FtsA [Az... 542 1e-152  Checked mark gi|68346679|gb|AAY94285.1| cell division protein FtsA [Pseudo... 541 1e-152 Gene info  Checked mark gi|88811833|ref|ZP_01127086.1| Cell division protein FtsA [Ni... 541 1e-152  Checked mark gi|59712804|ref|YP_205580.1| cell division protein [Vibrio fi... 540 4e-152 Gene info  Checked mark gi|71557836|gb|AAZ37047.1| cell division protein FtsA [Pseudo... 540 5e-152 Gene info  Checked mark gi|71145113|gb|AAZ25586.1| cell division protein FtsA [Colwel... 540 6e-152 Gene info  Checked mark gi|67677010|ref|ZP_00473752.1| Cell division protein FtsA [Ch... 540 6e-152  Checked mark gi|86148543|ref|ZP_01066830.1| cell division protein [Vibrio ... 538 1e-151  Checked mark gi|11761338|dbj|BAB19205.1| FtsA [Shewanella violacea] 538 1e-151  Checked mark gi|69951271|ref|ZP_00639012.1| Cell division protein FtsA [Sh... 538 2e-151  Checked mark gi|66047325|ref|YP_237166.1| Cell division protein FtsA [Pseu... 538 2e-151 Gene info  Checked mark gi|76884621|gb|ABA59302.1| Cell division protein FtsA [Nitros... 537 3e-151 Gene info  Checked mark gi|28871539|ref|NP_794158.1| cell division protein FtsA [Pseu... 537 3e-151 Gene info  Checked mark gi|26988075|ref|NP_743500.1| cell division protein FtsA [Pseu... 536 6e-151 Gene info  Checked mark gi|24375701|ref|NP_719744.1| cell division protein FtsA [Shew... 536 8e-151 Gene info  Checked mark gi|82742141|ref|ZP_00904843.1| Cell division protein FtsA [Sh... 536 8e-151  Checked mark gi|9950640|gb|AAG07796.1| cell division protein FtsA [Pseudom... 535 1e-150 Gene info  Checked mark gi|68547969|ref|ZP_00587491.1| Cell division protein FtsA [Sh... 535 2e-150  Checked mark gi|34499794|ref|NP_904009.1| cell division protein ftsA [Chro... 534 3e-150 Gene info  Checked mark gi|77955512|ref|ZP_00819874.1| Cell division protein FtsA [Ma... 533 5e-150  Checked mark gi|25166158|dbj|BAC24349.1| ftsA [Wigglesworthia glossinidia ... 533 7e-150 Gene info  Checked mark gi|48861175|ref|ZP_00315079.1| COG0849: Actin-like ATPase inv... 533 7e-150  Checked mark gi|82738698|ref|ZP_00901525.1| Cell division protein FtsA [Ps... 531 1e-149  Checked mark gi|89093035|ref|ZP_01165986.1| cell division protein FtsA [Oc... 531 2e-149  Checked mark gi|2707899|gb|AAB92376.1| FtsA [Pseudomonas putida] 531 2e-149  Checked mark gi|88799420|ref|ZP_01114997.1| cell division protein FtsA [Re... 529 8e-149  Checked mark gi|71796038|gb|AAZ40789.1| cell division protein [Candidatus ... 524 3e-147 Gene info  Checked mark gi|78363218|gb|ABB41183.1| cell division protein FtsA [Thiomi... 522 1e-146 Gene info  Checked mark gi|56312266|emb|CAI06911.1| cell division protein FTSA [Azoar... 522 1e-146 Gene info  Checked mark gi|71550341|ref|ZP_00670466.1| Cell division protein FtsA [Ni... 522 1e-146  Checked mark gi|71848727|gb|AAZ48223.1| Cell division protein FtsA [Dechlo... 521 1e-146 Gene info  Checked mark gi|85712529|ref|ZP_01043577.1| Cell division ATPase, FtsA [Id... 519 6e-146  Checked mark gi|68247429|gb|EAN29515.1| Cell division protein FtsA [Magnet... 519 7e-146  Checked mark gi|76876326|emb|CAI87548.1| Cell division protein [Pseudoalte... 517 4e-145 Gene info  Checked mark gi|76794187|ref|ZP_00776661.1| Cell division protein FtsA [Ps... 517 4e-145  Checked mark gi|68214326|ref|ZP_00566150.1| Cell division protein FtsA [Me... 516 5e-145  Checked mark gi|74020125|ref|ZP_00690731.1| Cell division protein FtsA [Bu... 516 7e-145  Checked mark gi|53755279|emb|CAH16773.1| ATP-binding cell division protein... 516 9e-145 Gene info  Checked mark gi|52629927|gb|AAU28668.1| cell division protein FtsA [Legion... 516 9e-145 Gene info  Checked mark gi|82703604|ref|YP_413170.1| cell division protein FtsA [Nitr... 513 5e-144 Gene info  Checked mark gi|48781047|ref|ZP_00277701.1| COG0849: Actin-like ATPase inv... 513 6e-144  Checked mark gi|17429863|emb|CAD16547.1| PROBABLE CELL DIVISION PROTEIN FT... 513 8e-144 Gene info  Checked mark gi|52429463|gb|AAU50056.1| cell division protein FtsA [Burkho... 512 9e-144 Gene info  Checked mark gi|30138616|emb|CAD84907.1| Cell division protein FtsA [Nitro... 511 3e-143 Gene info  Checked mark gi|52211045|emb|CAH37033.1| cell division protein FtsA [Burkh... 510 3e-143 Gene info  Checked mark gi|71836424|ref|ZP_00676193.1| Cell division protein FtsA [Pe... 510 3e-143  Checked mark gi|27360153|gb|AAO09091.1| Cell division protein FtsA [Vibrio... 510 4e-143 Gene info  Checked mark gi|82495625|ref|ZP_00881199.1| Cell division protein FtsA [Sh... 510 5e-143  Checked mark gi|83748770|ref|ZP_00945785.1| FtsA [Ralstonia solanacearum U... 510 5e-143  Checked mark gi|88858806|ref|ZP_01133447.1| Cell division protein [Pseudoa... 509 6e-143  Checked mark gi|77965870|gb|ABB07250.1| Cell division protein FtsA [Burkho... 509 7e-143 Gene info  Checked mark gi|78192892|gb|ABB30659.1| Cell division protein FtsA [Geobac... 509 8e-143 Gene info  Checked mark gi|72120072|gb|AAZ62335.1| Cell division protein FtsA [Ralsto... 509 9e-143 Gene info  Checked mark gi|84360668|ref|ZP_00985364.1| COG0849: Actin-like ATPase inv... 509 9e-143  Checked mark gi|78034820|emb|CAJ22465.1| cell division protein FtsA [Xanth... 509 1e-142 Gene info  Checked mark gi|67548901|ref|ZP_00426780.1| Cell division protein FtsA [Bu... 508 1e-142  Checked mark gi|68559742|ref|ZP_00599073.1| Cell division protein FtsA [Ra... 508 1e-142  Checked mark gi|84369197|dbj|BAE70355.1| cell division protein [Xanthomona... 508 2e-142 Gene info  Checked mark gi|89095255|ref|ZP_01168176.1| Cell division protein FtsA [Oc... 508 2e-142  Checked mark gi|68543485|ref|ZP_00583188.1| Cell division protein FtsA [Sh... 506 8e-142  Checked mark gi|56178561|gb|AAV81283.1| Cell division ATPase, FtsA [Idioma... 505 2e-141 Gene info  Checked mark gi|33568800|emb|CAE34558.1| cell division protein FtsA [Borde... 504 2e-141 Gene info  Checked mark gi|88937535|ref|ZP_01143097.1| Cell division protein FtsA [Ge... 504 2e-141  Checked mark gi|39985101|gb|AAR36456.1| cell division protein FtsA [Geobac... 504 2e-141 Gene info  Checked mark gi|77545874|gb|ABA89436.1| cell division protein FtsA [Peloba... 503 5e-141 Gene info  Checked mark gi|71163927|gb|EAO13642.1| Cell division protein FtsA [Xylell... 503 5e-141  Checked mark gi|28199731|ref|NP_780045.1| cell division protein [Xylella f... 502 1e-140 Gene info  Checked mark gi|86160195|ref|YP_466980.1| cell division protein FtsA [Anae... 502 1e-140 Gene info  Checked mark gi|9105699|gb|AAF83611.1| cell division protein [Xylella fast... 498 1e-139 Gene info  Checked mark gi|33517282|emb|CAD83666.1| cell division protein FtsA [Candi... 498 2e-139 Gene info  Checked mark gi|87122623|ref|ZP_01078500.1| cell division protein FtsA [Ma... 496 8e-139  Checked mark gi|46450324|gb|AAS96972.1| cell division protein FtsA [Desulf... 495 2e-138 Gene info  Checked mark gi|68177554|ref|ZP_00550701.1| Cell division protein FtsA [De... 491 2e-137  Checked mark gi|88794391|ref|ZP_01110099.1| cell division protein FtsA [Al... 489 7e-137  Checked mark gi|78218498|gb|ABB37847.1| cell division protein FtsA [Desulf... 489 8e-137 Gene info  Checked mark gi|71548015|ref|ZP_00668508.1| Cell division protein FtsA [Sy... 483 8e-135  Checked mark gi|68057890|gb|AAX88143.1| cell division protein FtsA [Haemop... 479 1e-133 Gene info  Checked mark gi|74024661|ref|ZP_00695194.1| Cell division protein FtsA [Rh... 477 3e-133  Checked mark gi|47574472|ref|ZP_00244508.1| COG0849: Actin-like ATPase inv... 474 2e-132  Checked mark gi|10038895|dbj|BAB12930.1| cell division protein ftsA [Buchn... 472 8e-132 Gene info  Checked mark gi|1169751|sp|P45068|FTSA_HAEIN Cell division protein ftsA >g... 472 1e-131  Checked mark gi|85858530|ref|YP_460732.1| cell division protein [Syntrophu... 471 2e-131 Gene info  Checked mark gi|67848311|ref|ZP_00503429.1| Cell division protein FtsA [Po... 469 7e-131  Checked mark gi|21623112|gb|AAM67771.1| cell division protein FtsA [Buchne... 469 1e-130 Gene info  Checked mark gi|84715213|ref|ZP_01022368.1| Cell division protein FtsA [Po... 468 2e-130  Checked mark gi|52307769|gb|AAU38269.1| FtsA protein [Mannheimia succinici... 468 2e-130 Gene info  Checked mark gi|7225649|gb|AAF40864.1| cell division protein FtsA [Neisser... 467 3e-130 Gene info  Checked mark gi|7380686|emb|CAB85276.1| cell division protein [Neisseria m... 466 7e-130 Gene info  Checked mark gi|2738588|gb|AAC46068.1| cell division protein [Buchnera aphidi 465 1e-129  Checked mark gi|83572614|gb|ABC19166.1| cell division protein FtsA [Moorel... 465 2e-129 Gene info  Checked mark gi|59801865|ref|YP_208577.1| FtsA [Neisseria gonorrhoeae FA 1... 464 4e-129 Gene info  Checked mark gi|53729115|ref|ZP_00134079.2| COG0849: Actin-like ATPase inv... 462 1e-128  Checked mark gi|75429980|ref|ZP_00732550.1| ATPases of the HSP70 class inv... 458 2e-127  Checked mark gi|33148197|gb|AAP95717.1| cell division protein FtsA [Haemop... 456 7e-127 Gene info  Checked mark gi|75234331|ref|ZP_00718709.1| COG0849: Actin-like ATPase inv... 452 2e-125  Checked mark gi|12720363|gb|AAK02230.1| FtsA [Pasteurella multocida subsp.... 451 4e-125 Gene info  Checked mark gi|39576781|emb|CAE80945.1| cell division protein FtsA [Bdell... 448 2e-124 Gene info  Checked mark gi|27904093|gb|AAO26927.1| cell division protein FtsA [Buchne... 447 4e-124 Gene info  Checked mark gi|46156643|ref|ZP_00132283.2| COG0849: Actin-like ATPase inv... 445 1e-123  Checked mark gi|20136385|gb|AAM11651.1| cell division protein FtsA [Azospiril 443 6e-123  Checked mark gi|89210851|ref|ZP_01189235.1| Cell division protein FtsA [Ha... 440 7e-122  Checked mark gi|88999609|emb|CAJ75587.1| FTSA protein [Geobacillus thermoleov 435 2e-120  Checked mark gi|83575195|gb|ABC21746.1| Cell division protein FtsA [Rhodos... 434 3e-120 Gene info  Checked mark gi|10175179|dbj|BAB06278.1| cell-division protein (septum for... 432 1e-119 Gene info  Checked mark gi|6458332|gb|AAF10210.1| cell division protein FtsA [Deinoco... 432 1e-119 Gene info  Checked mark gi|46201828|ref|ZP_00054266.2| COG0849: Actin-like ATPase inv... 431 2e-119  Checked mark gi|15075191|emb|CAC46748.1| CELL DIVISION PROTEIN [Sinorhizob... 430 4e-119 Gene info  Checked mark gi|89099617|ref|ZP_01172492.1| cell division protein (septum ... 429 7e-119  Checked mark gi|56379501|dbj|BAD75409.1| cell division protein (septum for... 429 9e-119 Gene info  Checked mark gi|82947793|dbj|BAE52657.1| Actin-like ATPase involved in cel... 428 3e-118 Gene info  Checked mark gi|23348273|gb|AAN30339.1| cell division protein FtsA [Brucel... 424 5e-117 Gene info  Checked mark gi|82700243|ref|YP_414817.1| Heat shock protein Hsp70:Cell di... 422 1e-116 Gene info  Checked mark gi|50877783|emb|CAG37623.1| probable cell division protein Ft... 422 1e-116 Gene info  Checked mark gi|25527251|gb|AAN04560.1| FtsA [Bacillus mycoides] 422 1e-116  Checked mark gi|47779267|gb|AAT38535.1| FtsA [Bartonella bacilliformis] >g... 422 2e-116  Checked mark gi|89203119|ref|ZP_01181816.1| Cell division protein FtsA [Ba... 421 2e-116  Checked mark gi|68193729|gb|EAN08381.1| Cell division protein FtsA [Mesorh... 421 3e-116  Checked mark gi|14022286|dbj|BAB48896.1| cell division protein; FtsA [Meso... 420 4e-116 Gene info  Checked mark gi|83816584|ref|YP_444706.1| cell division protein FtsA [Sali... 420 5e-116 Gene info  Checked mark gi|75762941|ref|ZP_00742744.1| Cell division protein ftsA [Ba... 419 9e-116  Checked mark gi|47504487|gb|AAT33163.1| cell division protein FtsA [Bacill... 419 1e-115 Gene info  Checked mark gi|56910362|dbj|BAD64889.1| cell division initiation protein ... 419 1e-115 Gene info  Checked mark gi|49239955|emb|CAF26360.1| Cell division protein ftsA [Barto... 419 1e-115 Gene info  Checked mark gi|17740547|gb|AAL43078.1| cell division protein [Agrobacteri... 419 1e-115 Gene info  Checked mark gi|22777155|dbj|BAC13428.1| cell-division protein (septum for... 418 2e-115 Gene info  Checked mark gi|29897552|gb|AAP10828.1| Cell division protein ftsA [Bacill... 417 4e-115 Gene info  Checked mark gi|42783000|ref|NP_980247.1| cell division protein FtsA [Baci... 417 4e-115 Gene info  Checked mark gi|34482388|emb|CAE09389.1| CELL DIVISION PROTEIN FTSA [Wolin... 415 1e-114 Gene info  Checked mark gi|49330000|gb|AAT60646.1| cell division protein [Bacillus th... 415 1e-114 Gene info  Checked mark gi|2633899|emb|CAB13401.1| cell-division protein [Bacillus su... 415 1e-114 Gene info  Checked mark gi|51975050|gb|AAU16600.1| cell division protein [Bacillus ce... 415 2e-114 Gene info  Checked mark gi|25527233|gb|AAN04556.1| FtsA [Bacillus mycoides] 415 2e-114  Checked mark gi|86137672|ref|ZP_01056249.1| cell division protein FtsA [Ro... 415 2e-114  Checked mark gi|69298116|ref|ZP_00620396.1| Cell division protein FtsA [Si... 414 3e-114  Checked mark gi|86358444|ref|YP_470336.1| cell division protein [Rhizobium... 414 4e-114 Gene info  Checked mark gi|49238658|emb|CAF27904.1| Cell division protein ftsA [Barto... 412 9e-114 Gene info  Checked mark gi|30526099|gb|AAP32281.1| FtsA [Bartonella henselae str. Housto 412 1e-113  Checked mark gi|83370089|ref|ZP_00914935.1| Cell division protein FtsA [Rh... 412 2e-113  Checked mark gi|83953975|ref|ZP_00962696.1| cell division protein FtsA [Su... 410 4e-113  Checked mark gi|24194053|gb|AAN47810.1| Cell division protein ftsA [Leptos... 410 4e-113 Gene info  Checked mark gi|52348006|gb|AAU40640.1| FtsA [Bacillus licheniformis DSM 1... 409 1e-112 Gene info  Checked mark gi|88801283|ref|ZP_01116811.1| cell division protein FtsA [Po... 409 1e-112  Checked mark gi|76259137|ref|ZP_00766788.1| Cell division protein FtsA [Ch... 409 1e-112  Checked mark gi|45658797|ref|YP_002883.1| FtsA [Leptospira interrogans ser... 409 1e-112 Gene info  Checked mark gi|78493918|ref|ZP_00846149.1| Cell division protein FtsA [Rh... 408 2e-112  Checked mark gi|2688166|gb|AAC66648.1| cell division protein (ftsA) [Borre... 408 3e-112 Gene info  Checked mark gi|52003341|gb|AAU23283.1| cell-division protein [Bacillus li... 408 3e-112 Gene info  Checked mark gi|77387083|gb|ABA78268.1| cell division protein FtsA [Rhodob... 408 3e-112 Gene info  Checked mark gi|86140620|ref|ZP_01059179.1| cell division protein FtsA [Fl... 407 4e-112  Checked mark gi|86132610|ref|ZP_01051203.1| cell division protein FtsA [Ce... 407 5e-112  Checked mark gi|83949545|ref|ZP_00958278.1| cell division protein FtsA [Ro... 407 6e-112  Checked mark gi|78698366|ref|ZP_00862869.1| Cell division protein FtsA [Br... 406 7e-112  Checked mark gi|27354877|dbj|BAC51862.1| cell division protein [Bradyrhizo... 406 7e-112 Gene info  Checked mark gi|66798160|ref|ZP_00396916.1| Cell division protein FtsA [De... 406 7e-112  Checked mark gi|85703760|ref|ZP_01034864.1| cell division protein FtsA [Ro... 406 8e-112  Checked mark gi|74420120|gb|ABA04319.1| Cell division protein FtsA [Nitrob... 406 1e-111 Gene info  Checked mark gi|1200208|emb|CAA78155.1| ftsA [Borrelia burgdorferi] >gi|12... 406 1e-111  Checked mark gi|69928979|ref|ZP_00625993.1| Cell division protein FtsA [Ni... 405 1e-111  Checked mark gi|77688127|ref|ZP_00803312.1| Cell division protein FtsA [Rh... 405 2e-111  Checked mark gi|83942735|ref|ZP_00955196.1| cell division protein FtsA [Su... 405 2e-111  Checked mark gi|77741184|ref|ZP_00809668.1| Cell division protein FtsA [Rh... 405 2e-111  Checked mark gi|51573132|gb|AAU07157.1| cell division protein [Borrelia ga... 404 4e-111 Gene info  Checked mark gi|84501761|ref|ZP_00999933.1| cell division protein FtsA [Oc... 404 5e-111  Checked mark gi|86134324|ref|ZP_01052906.1| cell division protein FtsA [Te... 403 7e-111  Checked mark gi|86749126|ref|YP_485622.1| cell division protein FtsA [Rhod... 402 1e-110 Gene info  Checked mark gi|85714981|ref|ZP_01045966.1| Cell division protein FtsA [Ni... 402 2e-110  Checked mark gi|48854568|ref|ZP_00308730.1| COG0849: Actin-like ATPase inv... 401 3e-110  Checked mark gi|20516649|gb|AAM24842.1| predicted ATPases of the HSP70 cla... 400 5e-110 Gene info  Checked mark gi|46199031|ref|YP_004698.1| cell division protein ftsA [Ther... 400 5e-110 Gene info  Checked mark gi|88806820|ref|ZP_01122336.1| cell division protein FtsA [Ro... 399 8e-110  Checked mark gi|78777491|ref|YP_393806.1| Cell division protein FtsA [Thio... 399 1e-109 Gene info  Checked mark gi|68196302|gb|EAN10731.1| Cell division protein FtsA [Entero... 399 1e-109  Checked mark gi|78170241|gb|ABB27337.1| Cell division protein FtsA [Chloro... 399 2e-109 Gene info  Checked mark gi|56677833|gb|AAV94499.1| cell division protein FtsA [Silici... 397 3e-109 Gene info  Checked mark gi|55772470|dbj|BAD70911.1| cell division protein FtsA [Therm... 397 4e-109 Gene info  Checked mark gi|77996717|gb|ABB15616.1| cell division protein FtsA [Carbox... 397 4e-109 Gene info  Checked mark gi|21645923|gb|AAM71279.1| cell division protein FtsA [Chloro... 397 6e-109 Gene info  Checked mark gi|39650441|emb|CAE28964.1| putative cell division protein Ft... 396 7e-109 Gene info  Checked mark gi|89055242|ref|YP_510693.1| cell division protein FtsA [Jann... 396 9e-109 Gene info  Checked mark gi|28271635|emb|CAD64541.1| cell division protein FtsA [Lacto... 395 1e-108 Gene info  Checked mark gi|73659908|emb|CAI82515.1| cell division protein FtsA [Dehal... 395 1e-108 Gene info  Checked mark gi|2222676|emb|CAA74237.1| ftsA [Enterococcus hirae] >gi|3122... 395 2e-108  Checked mark gi|83856722|ref|ZP_00950251.1| Cell division protein FtsA [Cr... 395 2e-108  Checked mark gi|88713167|ref|ZP_01107251.1| cell division protein FtsA [Fl... 395 2e-108  Checked mark gi|84686346|ref|ZP_01014240.1| cell division protein FtsA [Rh... 394 3e-108  Checked mark gi|81428364|ref|YP_395364.1| Cell division protein, FtsA [Lac... 394 3e-108 Gene info  Checked mark gi|68552729|ref|ZP_00592115.1| Cell division protein FtsA [Pr... 394 4e-108  Checked mark gi|53692772|ref|ZP_00122125.2| COG0849: Actin-like ATPase inv... 393 6e-108  Checked mark gi|57225356|gb|AAW40413.1| cell division protein FtsA [Dehalo... 393 7e-108 Gene info  Checked mark gi|29343039|gb|AAO80802.1| cell division protein FtsA [Entero... 393 7e-108 Gene info  Checked mark gi|89067820|ref|ZP_01155264.1| cell division protein FtsA [Oc... 393 8e-108  Checked mark gi|78167850|gb|ABB24948.1| Cell division protein FtsA [Pelodi... 392 1e-107 Gene info  Checked mark gi|57224977|gb|AAW40034.1| cell division protein FtsA [Dehalo... 389 9e-107 Gene info  Checked mark gi|67938385|ref|ZP_00530911.1| Cell division protein FtsA [Ch... 389 1e-106  Checked mark gi|76796244|ref|ZP_00778610.1| Cell division protein FtsA [Th... 388 2e-106  Checked mark gi|67918625|ref|ZP_00512221.1| Cell division protein FtsA [Ch... 387 4e-106  Checked mark gi|69936397|ref|ZP_00631223.1| Cell division protein FtsA [Pa... 387 7e-106  Checked mark gi|56551732|ref|YP_162571.1| cell division protein [Zymomonas... 386 8e-106 Gene info  Checked mark gi|15459172|gb|AAL00315.1| Cell division protein FtsA [Strept... 386 1e-105 Gene info  Checked mark gi|89257156|ref|YP_514518.1| cell division protein FtsA [Fran... 384 4e-105  Checked mark gi|42526712|ref|NP_971810.1| cell division protein FtsA [Trep... 384 5e-105 Gene info  Checked mark gi|56707352|ref|YP_169248.1| cell division protein FtsA [Fran... 383 7e-105 Gene info  Checked mark gi|5834365|gb|AAD53931.1| cell division protein FtsA [Zymomonas 382 1e-104  Checked mark gi|16414653|emb|CAC97369.1| ftsA [Listeria innocua] >gi|16801... 382 2e-104 Gene info  Checked mark gi|32262328|gb|AAP77376.1| cell division protein FtsA [Helico... 381 3e-104 Gene info  Checked mark gi|73660190|emb|CAI82797.1| cell division protein FtsA [Dehal... 380 4e-104 Gene info  Checked mark gi|46908269|ref|YP_014658.1| cell division protein FtsA [List... 380 7e-104 Gene info  Checked mark gi|16411503|emb|CAD00111.1| ftsA [Listeria monocytogenes] >gi... 380 7e-104 Gene info  Checked mark gi|83858910|ref|ZP_00952432.1| FtsA, cell division protein Ft... 380 8e-104  Checked mark gi|55738686|gb|AAV62327.1| cell division protein [Streptococc... 377 4e-103 Gene info  Checked mark gi|55820800|ref|YP_139242.1| cell division protein [Streptoco... 377 5e-103 Gene info  Checked mark gi|88939985|ref|ZP_01145428.1| cell division protein FtsA [Ac... 376 9e-103  Checked mark gi|68551365|ref|ZP_00590777.1| Cell division protein FtsA [Pe... 375 1e-102  Checked mark gi|67934906|ref|ZP_00527931.1| Cell division protein FtsA [Ch... 375 2e-102  Checked mark gi|77814543|ref|ZP_00813801.1| Cell division protein FtsA [Sh... 374 3e-102  Checked mark gi|3322667|gb|AAC65373.1| cell division protein (ftsA) [Trepo... 372 2e-101 Gene info  Checked mark gi|71490679|gb|EAO23040.1| Cell division protein FtsA [Syntro... 372 2e-101  Checked mark gi|62514808|ref|ZP_00386303.1| COG0849: Actin-like ATPase inv... 372 2e-101  Checked mark gi|2983169|gb|AAC06770.1| cell division protein FtsA [Aquifex... 371 4e-101 Gene info  Checked mark gi|89091152|ref|ZP_01164174.1| Cell division protein FtsA [La... 370 6e-101  Checked mark gi|71853845|gb|AAZ51868.1| cell division protein [Streptococc... 368 3e-100 Gene info  Checked mark gi|48870412|ref|ZP_00323135.1| COG0849: Actin-like ATPase inv... 367 3e-100  Checked mark gi|24376927|gb|AAN58293.1| cell division protein FtsA [Strept... 367 4e-100 Gene info  Checked mark gi|62462951|ref|ZP_00382313.1| COG0849: Actin-like ATPase inv... 365 2e-99  Checked mark gi|71481296|ref|ZP_00661003.1| Cell division protein FtsA [Pr... 365 2e-99  Checked mark gi|77408405|ref|ZP_00785145.1| cell division protein FtsA [St... 364 3e-99  Checked mark gi|76562339|gb|ABA44923.1| cell division protein FtsA [Strept... 364 4e-99 Gene info  Checked mark gi|23094947|emb|CAD46169.1| ftsA [Streptococcus agalactiae NE... 363 5e-99 Gene info  Checked mark gi|88597116|ref|ZP_01100352.1| cell division protein FtsA [Ca... 363 8e-99  Checked mark gi|4138103|emb|CAA75615.1| cell division protein FtsA [Lactococc 363 1e-98  Checked mark gi|67004958|gb|AAY61884.1| Cell division protein FtsA [Ricket... 363 1e-98 Gene info  Checked mark gi|12724902|gb|AAK05968.1| cell division protein FtsA [Lactoc... 362 2e-98 Gene info  Checked mark gi|57165802|gb|AAW34581.1| cell division protein FtsA [Campyl... 362 2e-98 Gene info  Checked mark gi|68537378|ref|ZP_00577158.1| Cell division protein FtsA [Sp... 361 3e-98  Checked mark gi|6968152|emb|CAB72969.1| cell division protein ftsA [Campyl... 361 3e-98 Gene info  Checked mark gi|51459761|gb|AAU03724.1| cell division protein FtsA [Ricket... 360 5e-98 Gene info  Checked mark gi|87305697|ref|ZP_01087851.1| cell division protein FtsA [Ca... 360 6e-98  Checked mark gi|58698051|ref|ZP_00372975.1| cell division protein FtsA [Wo... 360 8e-98  Checked mark gi|42453475|ref|ZP_00153382.1| COG0849: Actin-like ATPase inv... 359 1e-97  Checked mark gi|15619397|gb|AAL02873.1| cell division protein ftsA [Ricket... 358 2e-97 Gene info  Checked mark gi|34580722|ref|ZP_00142202.1| cell division protein ftsA [Ri... 358 3e-97  Checked mark gi|42409805|gb|AAS13917.1| cell division protein FtsA [Wolbac... 358 3e-97 Gene info  Checked mark gi|58001062|gb|AAW59956.1| Cell division protein FtsA [Glucon... 357 4e-97 Gene info  Checked mark gi|58418689|gb|AAW70704.1| Actin-like ATPase involved in cell... 357 4e-97 Gene info  Checked mark gi|57167706|ref|ZP_00366846.1| cell division protein FtsA [Ca... 357 4e-97  Checked mark gi|52698638|ref|ZP_00340046.1| COG0849: Actin-like ATPase inv... 357 7e-97  Checked mark gi|87134841|gb|ABD25583.1| cell division protein FtsA [Novosp... 353 6e-96 Gene info  Checked mark gi|84786274|gb|ABC62456.1| cell division protein [Erythrobact... 352 2e-95 Gene info  Checked mark gi|38570332|gb|AAR24614.1| FtsA [Caulobacter vibrioides] >gi|... 350 5e-95  Checked mark gi|2149908|gb|AAC45638.1| cell division protein [Enterococcus fa 348 2e-94  Checked mark gi|58417221|emb|CAI28334.1| Cell division protein ftsa [Ehrli... 347 8e-94 Gene info  Checked mark gi|56417148|ref|YP_154222.1| cell division protein FTSA [Anap... 347 8e-94 Gene info  Checked mark gi|3860813|emb|CAA14713.1| CELL DIVISION PROTEIN FTSA (ftsA) ... 346 1e-93 Gene info  Checked mark gi|57242051|ref|ZP_00369991.1| cell division protein FtsA [Ca... 345 1e-93  Checked mark gi|88607356|ref|YP_505720.1| cell division protein FtsA [Anap... 343 8e-93 Gene info  Checked mark gi|85707771|ref|ZP_01038837.1| cell division protein [Erythro... 343 1e-92  Checked mark gi|57161646|emb|CAH58575.1| cell division protein FtsA [Ehrli... 342 2e-92 Gene info  Checked mark gi|23024799|ref|ZP_00063994.1| COG0849: Actin-like ATPase inv... 341 4e-92  Checked mark gi|49532446|emb|CAG70158.1| cell division protein [Acinetobac... 340 6e-92 Gene info  Checked mark gi|57240593|ref|ZP_00368542.1| cell division protein FtsA [Ca... 339 1e-91  Checked mark gi|72394630|gb|AAZ68907.1| Cell division protein FtsA [Ehrlic... 339 1e-91 Gene info  Checked mark gi|22533496|gb|AAM99380.1| cell division protein FtsA [Strept... 338 2e-91 Gene info  Checked mark gi|67927915|ref|ZP_00521105.1| Cell division protein FtsA [So... 338 4e-91  Checked mark gi|68055466|ref|ZP_00539611.1| Cell division protein FtsA [Ex... 337 6e-91  Checked mark gi|47094597|ref|ZP_00232244.1| cell division protein FtsA [Li... 336 1e-90  Checked mark gi|42518899|ref|NP_964829.1| cell division protein FtsA [Lact... 335 2e-90 Gene info  Checked mark gi|52858228|ref|ZP_00046268.2| COG0849: Actin-like ATPase inv... 334 4e-90  Checked mark gi|88657794|ref|YP_507875.1| cell division protein FtsA [Ehrl... 334 4e-90 Gene info  Checked mark gi|68562889|ref|ZP_00602119.1| Cell division protein FtsA [Ru... 334 5e-90  Checked mark gi|88607641|ref|YP_505703.1| cell division protein FtsA [Anap... 332 2e-89 Gene info  Checked mark gi|47097645|ref|ZP_00235164.1| cell division protein FtsA [Li... 331 4e-89  Checked mark gi|86155593|ref|ZP_01073757.1| cell division protein ftsa [Ca... 330 7e-89  Checked mark gi|15024656|gb|AAK79658.1| Cell division protein, ftsA [Clost... 320 5e-86 Gene info  Checked mark gi|28203256|gb|AAO35699.1| cell division protein ftsA [Clostr... 320 1e-85 Gene info  Checked mark gi|4155486|gb|AAD06487.1| septum formation protein [Helicobac... 316 1e-84 Gene info  Checked mark gi|15645593|ref|NP_207769.1| cell division protein (ftsA) pro... 314 5e-84 Gene info  Checked mark gi|58254437|gb|AAV42674.1| cell division protein [Lactobacill... 309 1e-82 Gene info  Checked mark gi|62516593|ref|ZP_00387941.1| COG0849: Actin-like ATPase inv... 300 9e-80  Checked mark gi|57285941|gb|AAW38035.1| cell division protein FtsA [Staphy... 297 4e-79 Gene info  Checked mark gi|73662895|ref|YP_301676.1| cell division protein [Staphyloc... 297 4e-79 Gene info  Checked mark gi|49244468|emb|CAG42896.1| putative cell division protein [S... 297 5e-79 Gene info  Checked mark gi|49241477|emb|CAG40163.1| putative cell division protein [S... 297 5e-79 Gene info  Checked mark gi|82750792|ref|YP_416533.1| cell division protein [Staphyloc... 296 8e-79 Gene info  Checked mark gi|27315322|gb|AAO04457.1| cell division protein [Staphylococ... 296 1e-78 Gene info  Checked mark gi|57866692|ref|YP_188333.1| cell division protein FtsA [Stap... 296 2e-78 Gene info  Checked mark gi|75821356|ref|ZP_00751283.1| COG0849: Actin-like ATPase inv... 293 1e-77  Checked mark gi|51856045|dbj|BAD40203.1| cell division protein FtsA [Symbi... 288 2e-76 Gene info  Checked mark gi|84516383|ref|ZP_01003742.1| cell division protein FtsA [Lo... 287 6e-76  Checked mark gi|68447455|dbj|BAE05039.1| cell division protein FtsA [Staph... 285 3e-75 Gene info  Checked mark gi|71364486|ref|ZP_00655074.1| Cell division protein FtsA [Ps... 284 4e-75  Checked mark gi|71039286|gb|AAZ19594.1| possible cell division protein Fts... 284 4e-75 Gene info  Checked mark gi|48865796|ref|ZP_00319654.1| COG0849: Actin-like ATPase inv... 278 3e-73  Checked mark gi|29340760|gb|AAO78551.1| cell division protein FtsA [Bacter... 270 8e-71 Gene info  Checked mark gi|67875549|ref|ZP_00504845.1| Cell division protein FtsA [Cl... 266 1e-69  Checked mark gi|75822196|ref|ZP_00751871.1| COG0849: Actin-like ATPase inv... 265 2e-69  Checked mark gi|58697043|ref|ZP_00372505.1| cell division protein FtsA [Wo... 264 4e-69  Checked mark gi|60491278|emb|CAH06026.1| putative cell division protein [B... 261 4e-68 Gene info  Checked mark gi|4981367|gb|AAD35917.1| cell division protein FtsA, putativ... 254 4e-66 Gene info  Checked mark gi|88608795|ref|YP_506313.1| cell division protein FtsA [Neor... 247 7e-64 Gene info  Checked mark gi|11514422|pdb|1E4G|T Chain T, Ftsa (Atp-Bound Form) From Therm 246 1e-63 Related structures  Checked mark gi|76795748|ref|ZP_00778120.1| ATPases of the HSP70 class inv... 244 5e-63  Checked mark gi|20517006|gb|AAM25168.1| predicted ATPases of the HSP70 cla... 241 4e-62 Gene info  Checked mark gi|5805059|emb|CAB53636.1| cell division protein [Prevotella alb 241 5e-62  Checked mark gi|2149897|gb|AAC45628.1| cell division protein [Staphylococc... 238 5e-61  Checked mark gi|82748273|ref|ZP_00910760.1| Cell division protein FtsA [Cl... 236 2e-60  Checked mark gi|19715121|gb|AAL95645.1| Cell division protein ftsA [Fusoba... 232 2e-59 Gene info  Checked mark gi|77684791|ref|ZP_00800211.1| cell division protein FtsA [Al... 231 3e-59  Checked mark gi|88946774|ref|ZP_01149842.1| FTSA related protein, predicte... 228 3e-58  Checked mark gi|34763162|ref|ZP_00144129.1| Cell division protein ftsA [Fu... 228 4e-58  Checked mark gi|89211486|ref|ZP_01189849.1| cell division protein [Halothe... 226 2e-57  Checked mark gi|2209034|dbj|BAA20534.1| FtsA [Porphyromonas gingivalis] 225 3e-57  Checked mark gi|34540392|ref|NP_904871.1| cell division protein FtsA [Porp... 224 4e-57 Gene info  Checked mark gi|28203129|gb|AAO35572.1| cell division protein ftsA [Clostr... 222 3e-56 Gene info  Checked mark gi|18145429|dbj|BAB81472.1| cell division protein [Clostridiu... 221 6e-56 Gene info  Checked mark gi|22777913|dbj|BAC14184.1| cell division protein [Oceanobaci... 220 8e-56 Gene info  Checked mark gi|89100109|ref|ZP_01172978.1| cell division protein [Bacillu... 220 9e-56  Checked mark gi|15023923|gb|AAK78989.1| FTSA related protein, predicted AT... 214 6e-54 Gene info  Checked mark gi|77995664|gb|ABB14563.1| putative cell division protein Fts... 213 9e-54 Gene info  Checked mark gi|82746397|ref|ZP_00908904.1| FTSA related protein, predicte... 211 5e-53  Checked mark gi|4981835|gb|AAD36352.1| cell division protein FtsA, putativ... 209 2e-52 Gene info  Checked mark gi|10175866|dbj|BAB06962.1| cell division protein [Bacillus h... 208 3e-52 Gene info  Checked mark gi|51856548|dbj|BAD40706.1| cell division protein [Symbiobact... 201 3e-50 Gene info  Checked mark gi|83573000|gb|ABC19552.1| Cell division protein FtsA [Moorel... 199 3e-49 Gene info  Checked mark gi|88945441|ref|ZP_01148611.1| Cell division protein FtsA [De... 184 5e-45  Checked mark gi|53748393|emb|CAH58726.1| hypothetical protein [Clostridium sp 177 1e-42  Checked mark gi|77545815|gb|ABA89377.1| type IV pilus biogenesis protein P... 165 2e-39 Gene info  Checked mark gi|39984020|gb|AAR35408.1| type IV pilus biogenesis protein P... 164 8e-39 Gene info  Checked mark gi|82497275|ref|ZP_00882832.1| Type IV pilus assembly protein... 149 2e-34 New sequence mark gi|78193446|gb|ABB31213.1| Type IV pilus assembly protein Pil... 148 5e-34 Gene info New sequence mark gi|78688068|ref|ZP_00852792.1| Type IV pilus assembly protein... 147 6e-34 New sequence mark gi|24371879|ref|NP_715921.1| type IV pilus biogenesis protein... 146 2e-33 Gene info New sequence mark gi|82744312|ref|ZP_00906885.1| Type IV pilus assembly protein... 143 1e-32 New sequence mark gi|69950149|ref|ZP_00638081.1| Type IV pilus assembly protein... 141 4e-32 New sequence mark gi|68545226|ref|ZP_00584777.1| Type IV pilus assembly protein... 141 5e-32  Checked mark gi|1213606|emb|CAA65155.1| ftsA [Campylobacter jejuni] 139 2e-31 New sequence mark gi|68540921|ref|ZP_00580669.1| Type IV pilus assembly protein... 138 4e-31  Checked mark gi|57233251|gb|AAW48212.1| cell division protein [Bacillus ce... 137 6e-31  Checked mark gi|37288961|gb|AAQ90691.1| cell division protein [Bacillus sp. A 136 2e-30  Checked mark gi|77995890|gb|ABB14789.1| type IV pilus assembly protein Pil... 136 2e-30 Gene info New sequence mark gi|69157289|gb|EAN69534.1| Type IV pilus assembly protein Pil... 134 5e-30 New sequence mark gi|88936657|ref|ZP_01142260.1| Type IV pilus assembly protein... 133 1e-29 New sequence mark gi|71838891|ref|ZP_00678647.1| Type IV pilus assembly protein... 132 2e-29 New sequence mark gi|86157069|ref|YP_463854.1| type IV pilus assembly protein P... 131 5e-29 Gene info  Checked mark gi|88931676|ref|ZP_01137369.1| Type IV pilus assembly protein... 129 2e-28 New sequence mark gi|78367664|ref|ZP_00837929.1| Type IV pilus assembly protein... 129 3e-28 New sequence mark gi|53756124|gb|AAU90415.1| type 4 fimbrial biogenesis protein... 126 2e-27 Gene info  Checked mark gi|20515898|gb|AAM24154.1| HSP70 class molecular chaperones i... 125 4e-27 Gene info  Checked mark gi|1196309|gb|AAB51401.1| putative [Borrelia burgdorferi] 124 1e-26 New sequence mark gi|78369896|gb|ABB43054.1| PilM [Myxococcus xanthus DK 1622] 124 1e-26  Checked mark gi|88804968|ref|ZP_01120488.1| cell shape-determining protein... 123 2e-26  Checked mark gi|83855534|ref|ZP_00949063.1| putative rod-shape determining... 123 2e-26 New sequence mark gi|76795769|ref|ZP_00778140.1| Cell shape determining protein... 122 3e-26  Checked mark gi|86131552|ref|ZP_01050150.1| putative rod-shape determining... 121 5e-26  Checked mark gi|86143874|ref|ZP_01062242.1| putative rod-shape determining... 121 5e-26 New sequence mark gi|82499412|ref|ZP_00884858.1| Cell shape determining protein... 120 8e-26 New sequence mark gi|51855199|dbj|BAD39357.1| cell shape determining protein [S... 120 8e-26 Gene info New sequence mark gi|89211696|ref|ZP_01190047.1| Cell shape determining protein... 120 1e-25 New sequence mark gi|58583593|ref|YP_202609.1| rod shape-determining protein [X... 119 2e-25 Gene info  Checked mark gi|88713395|ref|ZP_01107478.1| cell shape-determining protein... 119 2e-25  Checked mark gi|67874083|ref|ZP_00503988.1| Cell shape determining protein... 119 2e-25 New sequence mark gi|22294661|dbj|BAC08490.1| rod shape-determining protein [Th... 119 2e-25 Gene info New sequence mark gi|78034703|emb|CAJ22348.1| Rod shape-determining protein [Xa... 118 6e-25 Gene info New sequence mark gi|66572360|gb|AAY47770.1| rod shape-determining protein [Xan... 117 9e-25 Gene info New sequence mark gi|21106764|gb|AAM35545.1| rod shape-determining protein [Xan... 117 9e-25 Gene info New sequence mark gi|84369345|dbj|BAE70503.1| rod shape-determining protein [Xa... 117 9e-25 Gene info  Checked mark gi|82501400|ref|ZP_00886735.1| Cell shape determining protein... 117 1e-24 New sequence mark gi|88940097|ref|ZP_01145539.1| cell shape determining protein... 117 1e-24 New sequence mark gi|77997004|gb|ABB15903.1| cell shape-determining protein Mre... 117 1e-24 Gene info New sequence mark gi|88799725|ref|ZP_01115299.1| Cell shape determining protein... 117 1e-24 New sequence mark gi|39574370|emb|CAE77874.1| rod shape-determining protein mre... 117 1e-24 Gene info New sequence mark gi|88944911|ref|ZP_01148133.1| Cell shape determining protein... 116 2e-24 New sequence mark gi|68212572|ref|ZP_00564408.1| Type IV pilus assembly protein... 115 3e-24 New sequence mark gi|87135825|gb|ABD26567.1| cell shape determining protein, Mr... 115 4e-24 Gene info New sequence mark gi|76795951|ref|ZP_00778321.1| Cell shape determining protein... 115 4e-24 New sequence mark gi|68179564|ref|ZP_00552611.1| Cell shape determining protein... 115 4e-24 New sequence mark gi|9106302|gb|AAF84118.1| rod shape-determining protein [Xyle... 114 6e-24 Gene info  Checked mark gi|86135264|ref|ZP_01053845.1| rod shape-determining protein ... 114 6e-24 New sequence mark gi|83647996|ref|YP_436431.1| Actin-like ATPase involved in ce... 113 1e-23 Gene info New sequence mark gi|34499812|ref|NP_904027.1| rod shape-determining protein mr... 113 1e-23 Gene info New sequence mark gi|87301691|ref|ZP_01084531.1| Rod shape determining protein ... 113 1e-23 New sequence mark gi|28198467|ref|NP_778781.1| rod shape-determining protein [X... 113 1e-23 Gene info New sequence mark gi|35212032|dbj|BAC89408.1| glr1467 [Gloeobacter violaceus PC... 113 1e-23 Gene info  Checked mark gi|88802127|ref|ZP_01117655.1| putative rod-shape determining... 113 1e-23  Checked mark gi|48856970|ref|ZP_00311127.1| COG1077: Actin-like ATPase inv... 113 1e-23 New sequence mark gi|83574724|gb|ABC21275.1| Cell shape determining protein Mre... 113 1e-23 Gene info New sequence mark gi|84787068|gb|ABC63250.1| ATPase [Erythrobacter litoralis HT... 113 1e-23 Gene info New sequence mark gi|18145808|dbj|BAB81849.1| rod shape-determining protein [Cl... 113 1e-23 Gene info New sequence mark gi|71543955|ref|ZP_00665014.1| Type IV pilus assembly protein... 113 1e-23 New sequence mark gi|71901840|ref|ZP_00683904.1| Cell shape determining protein... 113 2e-23 New sequence mark gi|89093934|ref|ZP_01166879.1| rod shape-determining protein ... 113 2e-23 New sequence mark gi|85686149|ref|ZP_01032693.1| COG1077: Actin-like ATPase inv... 113 2e-23 New sequence mark gi|20515151|gb|AAM23472.1| HSP70 class molecular chaperones i... 113 2e-23 Gene info  Checked mark gi|28271738|emb|CAD64644.1| cell shape determining protein Mr... 113 2e-23 Gene info  Checked mark gi|10802652|gb|AAG23549.1| cell division protein [Carboxydotherm 112 2e-23 New sequence mark gi|66797619|ref|ZP_00396378.1| Type IV pilus assembly protein... 112 3e-23 New sequence mark gi|67677064|ref|ZP_00473806.1| Cell shape determining protein... 112 3e-23 New sequence mark gi|56686180|dbj|BAD79402.1| rod shape-determining protein Mre... 112 3e-23 Gene info New sequence mark gi|88861014|ref|ZP_01135649.1| putative Type IV pilus biogene... 112 3e-23 New sequence mark gi|53756429|gb|AAU90720.1| rod shape-determining protein MreB... 112 3e-23 Gene info New sequence mark gi|77544737|gb|ABA88299.1| rod shape-determining protein MreB... 112 3e-23 Gene info New sequence mark gi|77996348|gb|ABB15247.1| Mbl protein [Carboxydothermus hydr... 112 4e-23 Gene info New sequence mark gi|78701751|ref|ZP_00866199.1| Cell shape determining protein... 112 4e-23 New sequence mark gi|71061841|gb|AAZ20844.1| cell division protein FtsA [Candid... 112 4e-23 Gene info New sequence mark gi|76882096|gb|ABA56777.1| Type IV pilus assembly protein Pil... 112 4e-23 Gene info New sequence mark gi|77685547|ref|ZP_00800942.1| Cell shape determining protein... 112 4e-23 New sequence mark gi|46448615|gb|AAS95269.1| rod shape-determining protein MreB... 111 5e-23 Gene info New sequence mark gi|88704052|ref|ZP_01101767.1| rod shape-determining protein ... 111 5e-23 New sequence mark gi|84701496|ref|ZP_01016071.1| rod shape-determining protein ... 111 5e-23 New sequence mark gi|86609926|ref|YP_478688.1| rod shape-determining protein [C... 111 5e-23 Gene info New sequence mark gi|42518887|ref|NP_964817.1| rod shape-determining protein Mr... 111 5e-23 Gene info  Checked mark gi|10173458|dbj|BAB04562.1| cell-shape determining protein [B... 111 7e-23 Gene info New sequence mark gi|82947453|dbj|BAE52317.1| Actin-like ATPase involved in cel... 111 7e-23 Gene info New sequence mark gi|76876546|emb|CAI87768.1| putative Type IV pilus biogenesis... 111 7e-23 Gene info New sequence mark gi|52003259|gb|AAU23201.1| cell-shape determining protein [Ba... 110 8e-23 Gene info New sequence mark gi|83572315|gb|ABC18867.1| cell shape determining protein, Mr... 110 8e-23 Gene info New sequence mark gi|23003788|ref|ZP_00047434.1| COG1077: Actin-like ATPase inv... 110 8e-23 New sequence mark gi|33632181|emb|CAE06637.1| Rod shape determining protein [Sy... 110 9e-23 Gene info New sequence mark gi|34541078|ref|NP_905557.1| cell shape-determining protein M... 110 9e-23 Gene info New sequence mark gi|26987669|ref|NP_743094.1| rod shape-determining protein Mr... 110 1e-22 Gene info New sequence mark gi|88705195|ref|ZP_01102906.1| fimbrial assembly protein PilM... 110 1e-22 New sequence mark gi|75701408|gb|ABA21084.1| Cell shape determining protein Mre... 110 1e-22 Gene info New sequence mark gi|143212|gb|AAA22605.1| putative 110 1e-22 New sequence mark gi|71368596|ref|ZP_00659088.1| Cell shape determining protein... 110 1e-22 New sequence mark gi|28271771|emb|CAD64677.1| cell shape determining protein Mr... 110 1e-22 Gene info New sequence mark gi|68055141|ref|ZP_00539289.1| Cell shape determining protein... 110 1e-22 New sequence mark gi|46201201|ref|ZP_00055538.2| COG1077: Actin-like ATPase inv... 110 1e-22 New sequence mark gi|49332970|gb|AAT63616.1| rod shape-determining protein [Bac... 110 1e-22 Gene info New sequence mark gi|78218448|gb|ABB37797.1| cell shape determining protein, Mr... 110 1e-22 Gene info New sequence mark gi|81428463|ref|YP_395463.1| Cell shape determining protein M... 110 1e-22 Gene info New sequence mark gi|78713599|gb|ABB50776.1| cell shape determining protein, Mr... 110 1e-22 Gene info New sequence mark gi|2635268|emb|CAB14763.1| cell-shape determining protein [Ba... 110 2e-22 Gene info New sequence mark gi|86605087|ref|YP_473850.1| rod shape-determining protein [C... 110 2e-22 Gene info New sequence mark gi|68563057|ref|ZP_00602271.1| Cell shape determining protein... 110 2e-22 New sequence mark gi|2983387|gb|AAC06972.1| rod shape determining protein MreB ... 109 2e-22 Gene info New sequence mark gi|71845473|gb|AAZ44969.1| Type IV pilus assembly protein Pil... 109 2e-22 Gene info New sequence mark gi|89205253|ref|ZP_01183824.1| Cell shape determining protein... 109 2e-22 New sequence mark gi|29898085|gb|AAP11359.1| Rod shape-determining protein mreB... 109 2e-22 Gene info New sequence mark gi|85708575|ref|ZP_01039641.1| ATPase [Erythrobacter sp. NAP1... 109 2e-22 New sequence mark gi|56381710|dbj|BAD77618.1| cell shape determining protein (M... 109 2e-22 Gene info New sequence mark gi|6983753|emb|CAB75392.1| rod shape-determining protein [Str... 109 2e-22 Gene info New sequence mark gi|58254426|gb|AAV42663.1| rod shape-determining protein [Lac... 109 2e-22 Gene info New sequence mark gi|29831998|ref|NP_826632.1| rod shape-determining protein [S... 109 2e-22 Gene info New sequence mark gi|17135065|dbj|BAB77611.1| rod shape-determining protein [No... 109 2e-22 Gene info New sequence mark gi|83574101|gb|ABC20653.1| cell shape determining protein, Mr... 109 2e-22 Gene info New sequence mark gi|72002887|gb|AAZ58689.1| Cell shape determining protein Mre... 109 3e-22 Gene info New sequence mark gi|56910622|dbj|BAD65149.1| rod shape-determining protein Mre... 109 3e-22 Gene info New sequence mark gi|10175653|dbj|BAB06750.1| cell-shape determining protein [B... 108 3e-22 Gene info New sequence mark gi|24196586|gb|AAN49958.1| rod shape-determining protein mreB... 108 3e-22 Gene info New sequence mark gi|88930748|ref|ZP_01136443.1| Cell shape determining protein... 108 3e-22 New sequence mark gi|12517874|gb|AAG58378.1| regulator of ftsI, penicillin bind... 108 3e-22 Gene info New sequence mark gi|3322787|gb|AAC65484.1| rod shape-determining protein (mreB... 108 3e-22 Gene info New sequence mark gi|88858676|ref|ZP_01133317.1| Rod shape-determining protein ... 108 3e-22 New sequence mark gi|15025903|gb|AAK80801.1| Shape-determining protein envB (HS... 108 4e-22 Gene info New sequence mark gi|89090783|ref|ZP_01163821.1| Cell shape determining protein... 108 4e-22 New sequence mark gi|49530015|emb|CAG67727.1| rod shape-determining protein [Ac... 108 4e-22 Gene info New sequence mark gi|15620327|gb|AAL03736.1| rod shape-determining protein mreB... 108 4e-22 Gene info New sequence mark gi|62181882|ref|YP_218299.1| Rod shape-determining protein mr... 108 4e-22 Gene info New sequence mark gi|52628158|gb|AAU26899.1| rod shape determining protein MreB... 108 4e-22 Gene info New sequence mark gi|85860510|ref|YP_462712.1| pili assembly protein [Syntrophu... 108 4e-22 Gene info New sequence mark gi|53753620|emb|CAH15078.1| Rod shape-determining protein Mre... 108 4e-22 Gene info New sequence mark gi|29542030|gb|AAO90968.1| rod shape-determining protein MreB... 108 4e-22 Gene info New sequence mark gi|84394129|ref|ZP_00992862.1| rod shape-determining protein ... 108 4e-22 New sequence mark gi|2633818|emb|CAB13320.1| cell-shape determining protein [Ba... 108 4e-22 Gene info New sequence mark gi|26110260|gb|AAN82446.1| Rod shape-determining protein mreB... 108 5e-22 Gene info New sequence mark gi|56383849|gb|AAN44753.2| regulator of ftsI, penicillin bind... 108 5e-22 Gene info New sequence mark gi|86147839|ref|ZP_01066145.1| rod shape-determining protein ... 108 5e-22 New sequence mark gi|23024393|ref|ZP_00063606.1| COG1077: Actin-like ATPase inv... 108 5e-22 New sequence mark gi|3861297|emb|CAA15196.1| ROD SHAPE-DETERMINING PROTEIN MREB... 108 5e-22 Gene info New sequence mark gi|68177942|ref|ZP_00551080.1| Type IV pilus assembly protein... 108 5e-22 New sequence mark gi|67005157|gb|AAY62083.1| Rod shape-determining protein MreB... 108 5e-22 Gene info New sequence mark gi|34581208|ref|ZP_00142688.1| rod shape-determining protein ... 108 6e-22 New sequence mark gi|58002582|gb|AAW61476.1| Rod shape-determining protein MreB... 108 6e-22 Gene info New sequence mark gi|71491093|gb|EAO23430.1| Cell shape determining protein Mre... 108 6e-22 New sequence mark gi|75816783|ref|ZP_00747243.1| COG1077: Actin-like ATPase inv... 108 6e-22 New sequence mark gi|33634396|emb|CAE20081.1| Rod shape determining protein [Pr... 108 6e-22 Gene info New sequence mark gi|56416728|ref|YP_153802.1| rod shape-determining protein [A... 107 6e-22 Gene info
Alignments
>gi|78100129|sp|P0ABH3|FTSA_SHIFL Cell division protein ftsA Length=439 Score = 602 bits (1554), Expect = 9e-171, Method: Composition-based stats. Identities = 420/420 (100%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|24050298|gb|AAN41756.1| Gene info ATP-binding cell division protein [Shigella flexneri 2a str. 301] gi|1786282|gb|AAC73205.1| Gene info ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli K12] gi|74310713|ref|YP_309132.1| Gene info ATP-binding cell division protein [Shigella sonnei Ss046] gi|82775501|ref|YP_401848.1| Gene info ATP-binding cell division protein [Shigella dysenteriae Sd197] gi|89106977|ref|AP_000757.1| ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli W3110] gi|26106424|gb|AAN78610.1| Gene info Cell division protein ftsA [Escherichia coli CFT073] gi|21321975|dbj|BAB96662.1| ATP-binding cell division protein involved in recruitment of FtsK to Z ring [Escherichia coli W3110] gi|40862|emb|CAA38871.1| FtsA protein [Escherichia coli] gi|30039903|gb|AAP15637.1| Gene info ATP-binding cell division protein [Shigella flexneri 2a str. 2457T] gi|82542698|ref|YP_406645.1| Gene info ATP-binding cell division protein [Shigella boydii Sb227] gi|13359554|dbj|BAB33521.1| Gene info ATP-binding cell division protein FtsA [Escherichia coli O157:H7] gi|30061661|ref|NP_835832.1| Gene info cell division protein [Shigella flexneri 2a str. 2457T] gi|24111539|ref|NP_706049.1| Gene info cell division protein [Shigella flexneri 2a str. 301] gi|16128087|ref|NP_414636.1| Gene info cell division protein [Escherichia coli K12] gi|15829352|ref|NP_308125.1| Gene info cell division protein [Escherichia coli O157:H7] gi|78100128|sp|P0ABH0|FTSA_ECOLI Cell division protein ftsA gi|78100127|sp|P0ABH1|FTSA_ECOL6 Cell division protein ftsA gi|78100126|sp|P0ABH2|FTSA_ECO57 Gene info Cell division protein ftsA gi|12512800|gb|AAG54398.1| Gene info ATP-binding cell division protein, septation process, complexes with FtsZ, associated with junctions of inner and outer membranes [Escherichia coli O157:H7 EDL933] gi|26246027|ref|NP_752066.1| Gene info cell division protein [Escherichia coli CFT073] gi|15799778|ref|NP_285790.1| Gene info cell division protein [Escherichia coli O157:H7 EDL933] gi|81239649|gb|ABB60359.1| Gene info ATP-binding cell division protein [Shigella dysenteriae Sd197] gi|75511682|ref|ZP_00734320.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli 53638] gi|75256034|ref|ZP_00727747.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E22] gi|75236012|ref|ZP_00720148.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli F11] gi|75229057|ref|ZP_00715637.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli B7A] gi|75209385|ref|ZP_00709617.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli B171] gi|75194311|ref|ZP_00704381.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli HS] gi|75189194|ref|ZP_00702461.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E24377A] gi|81244109|gb|ABB64817.1| Gene info ATP-binding cell division protein [Shigella boydii Sb227] gi|83585184|ref|ZP_00923834.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli 101-1] gi|73854190|gb|AAZ86897.1| Gene info ATP-binding cell division protein [Shigella sonnei Ss046] Length=420 Score = 597 bits (1541), Expect = 3e-169, Method: Composition-based stats. Identities = 420/420 (100%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|146032|gb|AAA23817.1| FtsA [Escherichia coli] gi|146025|gb|AAA23811.1| cell division protein Length=420 Score = 595 bits (1537), Expect = 9e-169, Method: Composition-based stats. Identities = 419/420 (99%), Positives = 419/420 (99%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGA QIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGARQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|36786949|emb|CAE16023.1| Gene info cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] gi|37527514|ref|NP_930858.1| Gene info cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] Length=418 Score = 586 bits (1513), Expect = 6e-166, Method: Composition-based stats. Identities = 384/420 (91%), Positives = 405/420 (96%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKV+ALVGE+LPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVSALVGEILPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDV+NVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVDNVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDE+R+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNI KAVERCGL Sbjct 121 VRDEYRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIAKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIF+GLA+SY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFSGLAASYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAE IKVRHGCALGS+V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAETIKVRHGCALGSLVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELLNLVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GLA CAQRVFH QVRIG Sbjct 301 YIELLNLVNDEILRLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLAECAQRVFHAQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQ+PYYSTAVGLLHYGK SHLNG+A++EK V SV W KR++SWL+KEF Sbjct 361 PLNITGLTDYAQQPYYSTAVGLLHYGKASHLNGDADIEKHV--SVSRWFKRVSSWLKKEF 418 >gi|85058430|ref|YP_454132.1| Gene info cell division protein FtsA [Sodalis glossinidius str. 'morsitans'] gi|84778950|dbj|BAE73727.1| Gene info cell division protein FtsA [Sodalis glossinidius str. 'morsitans'] Length=418 Score = 583 bits (1506), Expect = 4e-165, Method: Composition-based stats. Identities = 393/420 (93%), Positives = 407/420 (96%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMD+AVYT GALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDMAVYTAGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALG++V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGAVVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+EILQLQE+LR QGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG Sbjct 301 YTELLNLVNDEILQLQEQLRAQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQ PYYSTAVGLLHYGKESHL+GE +VEKR SV +W KR + WLRKEF Sbjct 361 PLNITGLTDYAQAPYYSTAVGLLHYGKESHLSGEVDVEKR--TSVSTWFKRFSGWLRKEF 418 >gi|16418632|gb|AAL19096.1| Gene info ATP-binding cell division protein [Salmonella typhimurium LT2] gi|16501417|emb|CAD01289.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Typhi] gi|62178699|ref|YP_215116.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|56126661|gb|AAV76167.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|29136301|gb|AAO67868.1| Gene info cell division protein FtsA [Salmonella enterica subsp. enterica serovar Typhi Ty2] gi|62126332|gb|AAX64035.1| Gene info ATP-binding cell division protein, septation process, complexes with FtsZ, associated with junctions of inner and outer membranes [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|16763522|ref|NP_459137.1| Gene info cell division protein [Salmonella typhimurium LT2] gi|56412404|ref|YP_149479.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|16759127|ref|NP_454744.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29140677|ref|NP_804019.1| Gene info cell division protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] gi|25300218|pir||AI0518 cell division protein FtsA [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) Length=420 Score = 582 bits (1502), Expect = 1e-164, Method: Composition-based stats. Identities = 418/420 (99%), Positives = 420/420 (100%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 >gi|45438226|gb|AAS63773.1| Gene info cell division protein FtsA [Yersinia pestis biovar Medievalis str. 91001] gi|21960593|gb|AAM87170.1| Gene info ATP-binding cell division protein [Yersinia pestis KIM] gi|51588324|emb|CAH19932.1| Gene info cell division protein FtsA [Yersinia pseudotuberculosis IP 32953] gi|15978651|emb|CAC89415.1| Gene info cell division protein FtsA [Yersinia pestis CO92] gi|22127496|ref|NP_670919.1| Gene info cell division protein [Yersinia pestis KIM] gi|51595042|ref|YP_069233.1| Gene info cell division protein [Yersinia pseudotuberculosis IP 32953] gi|45443357|ref|NP_994896.1| Gene info cell division protein [Yersinia pestis biovar Medievalis str. 91001] gi|16120887|ref|NP_404200.1| Gene info cell division protein [Yersinia pestis CO92] gi|89102560|ref|ZP_01175184.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pestis biovar Orientalis str. IP275] gi|77977548|ref|ZP_00832993.1| COG0849: Actin-like ATPase involved in cell division [Yersinia intermedia ATCC 29909] gi|77976096|ref|ZP_00831629.1| COG0849: Actin-like ATPase involved in cell division [Yersinia frederiksenii ATCC 33641] gi|77962102|ref|ZP_00825927.1| COG0849: Actin-like ATPase involved in cell division [Yersinia mollaretii ATCC 43969] gi|77958231|ref|ZP_00822268.1| COG0849: Actin-like ATPase involved in cell division [Yersinia bercovieri ATCC 43970] gi|77633647|ref|ZP_00795769.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pestis Angola] gi|77631672|ref|ZP_00794258.1| COG0849: Actin-like ATPase involved in cell division [Yersinia pseudotuberculosis IP 31758] Length=418 Score = 575 bits (1485), Expect = 1e-162, Method: Composition-based stats. Identities = 399/420 (95%), Positives = 413/420 (98%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG Sbjct 301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR ASVG+W KR+NSWLRKEF Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418 >gi|46914741|emb|CAG21518.1| Gene info putative cell division protein FtsA [Photobacterium profundum SS9] gi|54310300|ref|YP_131320.1| Gene info cell division protein [Photobacterium profundum SS9] Length=418 Score = 570 bits (1471), Expect = 4e-161, Method: Composition-based stats. Identities = 314/420 (74%), Positives = 368/420 (87%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D+KL+VGL+IGT+KV ALVGEVLPDG VN+IGVGS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADKKLIVGLDIGTSKVCALVGEVLPDGNVNVIGVGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQISSVYL+LSGKHISCQ E GMVPIS++EVTQ+DV+NV+HTAKSV+ Sbjct 61 VQRAVDQAELMADCQISSVYLSLSGKHISCQTEKGMVPISDKEVTQDDVDNVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DEHR LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMA+NIVKAVERCGL Sbjct 121 ISDEHRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMARNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD LIF+GLA+S++VLT DERELGVCVVDIGGGTMD+AV++GGALRH +VIPYAGNVVT Sbjct 181 KVDHLIFSGLAASHAVLTPDERELGVCVVDIGGGTMDLAVWSGGALRHAEVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP DAE IKV++GCAL +V KD V+VPSVGGRP RSLQ QTLAEVIEPR Sbjct 241 SDIAYAFGTPLGDAEEIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN++++ +Q+++R GVKHHLAAGIVLTGGA+Q+EGL CA+RVF QVRIG Sbjct 301 YSELLGLVNQKLIDIQDQMRDAGVKHHLAAGIVLTGGASQMEGLIECAERVFRNQVRIGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GLTDY Q P+++TAVGLLHYGK+S ++++E + SV R++ W +KEF Sbjct 361 PLELNGLTDYVQAPHFATAVGLLHYGKDSQAFDDSDIEPK--RSVSGLFARISGWFKKEF 418 >gi|49613259|emb|CAG76710.1| Gene info cell division protein [Erwinia carotovora subsp. atroseptica SCRI1043] gi|50122733|ref|YP_051900.1| Gene info cell division protein [Erwinia carotovora subsp. atroseptica SCRI1043] Length=418 Score = 566 bits (1462), Expect = 4e-160, Method: Composition-based stats. Identities = 399/420 (95%), Positives = 413/420 (98%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK+TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKSTDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQ+DVE+VVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQDDVESVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP+DAEAIKVRHGCALG+IVGKDE+VEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPTDAEAIKVRHGCALGAIVGKDENVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVN+E+LQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG Sbjct 301 YTELLNLVNDELLQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+NITGLTDYAQEPYYSTAVGLLHYGKESHL GE EVEKR ASV +W KR+NSWLRKEF Sbjct 361 PMNITGLTDYAQEPYYSTAVGLLHYGKESHLGGEHEVEKR--ASVSNWFKRINSWLRKEF 418 >gi|75175651|ref|ZP_00695859.1| COG0849: Actin-like ATPase involved in cell division [Shigella boydii BS512] Length=399 Score = 562 bits (1450), Expect = 1e-158, Method: Composition-based stats. Identities = 399/399 (100%), Positives = 399/399 (100%), Gaps = 0/399 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA Sbjct 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK 399 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK Sbjct 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK 399 >gi|89074167|ref|ZP_01160666.1| cell division protein [Photobacterium sp. SKA34] gi|89050103|gb|EAR55629.1| cell division protein [Photobacterium sp. SKA34] Length=418 Score = 560 bits (1446), Expect = 3e-158, Method: Composition-based stats. Identities = 319/420 (75%), Positives = 367/420 (87%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D+KL+VGL+IGT++V ALVGEVLPD VN+IG+GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADQKLIVGLDIGTSEVTALVGEVLPDNTVNVIGMGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+D+AELMA+CQISSVYL+LSGKHISCQ E GMVPISE+EVTQ+DV+NV+HTAKSV+ Sbjct 61 VQRAVDKAELMAECQISSVYLSLSGKHISCQTEKGMVPISEKEVTQDDVDNVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMAKNIVKAVERC L Sbjct 121 LSDEQRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMAKNIVKAVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD LIF+GLASSY+VLT DERELGVCVVDIGGGTMD+A+++GGALRH +VIPYAGNVVT Sbjct 181 KVDHLIFSGLASSYAVLTPDERELGVCVVDIGGGTMDLAIWSGGALRHAEVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPP DAE IKV++GCAL +V KD V+VPSVGGRP RSLQ QTLAEVIEPR Sbjct 241 SDIAYAFGTPPGDAEDIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN+++L +QE+LR+ GVKHHLAAGIVLTGGAAQ+EGL CA+RVF QVRIG Sbjct 301 YSELLGLVNQKLLTVQEQLREAGVKHHLAAGIVLTGGAAQMEGLTECAERVFRHQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY Q P Y+TAVGLLHYGK+S E E+E + SV R++ WL+KEF Sbjct 361 PLELSGLTDYVQAPTYATAVGLLHYGKDSQSFDENELEPK--RSVTGLFSRISGWLKKEF 418 >gi|78701777|ref|ZP_00866224.1| Cell division protein FtsA [Alkalilimnicola ehrlichei MLHE-1] gi|78520659|gb|EAP33919.1| Cell division protein FtsA [Alkalilimnicola ehrlichei MLHE-1] Length=412 Score = 551 bits (1423), Expect = 2e-155, Method: Composition-based stats. Identities = 214/420 (50%), Positives = 293/420 (69%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K ++R L+VGL+IGT+KV A+VGE DG + ++G+GS PS G+ KG V ++ES V+ Sbjct 1 MVKKSERNLLVGLDIGTSKVVAIVGEAGEDGEIEVVGIGSHPSSGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+++AELMA C+I S Y+ +SG HI N GMV I + EVTQ D++ V+ A++V Sbjct 61 VQRAVEEAELMAGCEIHSAYVGISGSHIKSMNSHGMVAIKDREVTQGDLDRVLDGARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + R+LHV+PQE+ ID QEGI++P+G+SGVR++A+VH++T A+NI K V RCGL Sbjct 121 IPADQRILHVLPQEFVIDNQEGIRHPLGMSGVRLEARVHMVTGAVSAAENITKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD ++ LAS+ +VLT+DERELGVC+VDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 EVDDVVLQQLASAQAVLTDDERELGVCLVDIGGGTTDIAVFTGGAIRHTAVIPIAGHQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKV++ CAL + +ES+EVPSVG RPPR L RQ+LA V+EPR Sbjct 241 NDIAVALRTPTQHAEEIKVKYACALSQLANPEESIEVPSVGDRPPRRLSRQSLAAVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV E LR+ G + + AG+VLTGG++++EG+ A+ VFH VR + Sbjct 301 YEELLGLVQAE-------LRRSGFEDLIPAGVVLTGGSSKMEGVVDLAEEVFHLPVRAAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +TGL+D + P YST VGLL YG H A + + + R+ SW + F Sbjct 354 PTQVTGLSDVVRNPIYSTGVGLLVYGAR-HEGKPALTDFSEEGGLQALWARMKSWFKGNF 412 >gi|88704104|ref|ZP_01101819.1| Cell division protein FtsA [gamma proteobacterium KT 71] gi|88701931|gb|EAQ99035.1| Cell division protein FtsA [gamma proteobacterium KT 71] Length=410 Score = 551 bits (1421), Expect = 2e-155, Method: Composition-based stats. Identities = 222/420 (52%), Positives = 298/420 (70%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A DR+++VGL+IGT+KV A+VGEVL DG + +IG+GS PS+GM KG V ++ES V+ Sbjct 1 MAAAKDRRMIVGLDIGTSKVVAIVGEVLADGSIEVIGIGSHPSKGMKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+D+AELMA CQI SVY+ ++G HI N G+V I E+EV +D+E V+ A++V Sbjct 61 IQRAVDEAELMAGCQIHSVYVGIAGSHIRSLNSHGIVAIKEQEVVGQDLERVIDAARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +VLHV+PQEY ID QEGIK P G+SGVR++AKVHL+TC + A+NI K + +CGL Sbjct 121 IPADQKVLHVLPQEYVIDSQEGIKEPQGMSGVRLEAKVHLVTCAVNAAQNIEKCIRKCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V+ +I LASSYSVLT+DERELGVC+VDIGGGT DIA++T G++RHT VIP AG+ VT Sbjct 181 EVEDIILEQLASSYSVLTDDERELGVCLVDIGGGTTDIAIFTEGSIRHTGVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G D++++VPSVG RPPR L RQ+LAEV+EPR Sbjct 241 NDIAMALRTPSQYAEEIKIRYACALTQLAGADQTIKVPSVGDRPPRDLSRQSLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + +GIVLTGG +++EG + A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGFEDLIPSGIVLTGGTSKMEGASELAEEIFHMPVRVGY 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +I GL D + P YSTAVGLL YG + AS +W RL+ W R F Sbjct 354 PQSIDGLADIVRNPIYSTAVGLLLYGSRHAGEVHGGAPR---ASGEAWWTRLSRWFRDSF 410 >gi|74316142|ref|YP_313882.1| Gene info Cell division protein FtsA [Thiobacillus denitrificans ATCC 25259] gi|74055637|gb|AAZ96077.1| Gene info Cell division protein FtsA [Thiobacillus denitrificans ATCC 25259] Length=411 Score = 548 bits (1415), Expect = 1e-154, Method: Composition-based stats. Identities = 199/421 (47%), Positives = 284/421 (67%), Gaps = 11/421 (2%) Query 1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 M K D + LVVGL+IGT+K+ +VGE+ +GM+ IIG+G+ PSRG+ +G V ++E+ V Sbjct 1 MSKPRDPKNLVVGLDIGTSKIVCIVGEINDEGMLEIIGMGTHPSRGLRRGVVVNIEATVN 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 +QRA+++AELMADC+I VY ++G HI N GM I ++E++Q DV+ VV TA++V Sbjct 61 AIQRALEEAELMADCKIREVYTGIAGSHIKSFNSHGMFAIKDKEISQMDVDRVVETARAV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + ++LH IPQE+ +D QE +++P+G+S VR++ KVH++T A+NI+K V RCG Sbjct 121 NIPTDQQILHTIPQEFIVDGQEDVRDPLGMSAVRLEVKVHIVTGAVSAAQNIIKCVRRCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+V L+ LAS+ +VLTEDE+ELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ V Sbjct 181 LEVGDLVLQPLASAMAVLTEDEKELGVCLVDIGGGTTDIAVFTNGAIRHTAVIPVAGDQV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA A TPP +AE IKV++GCAL + + +EVP +G RPPR+L RQTLAE IEP Sbjct 241 NNDIAVALRTPPKEAEDIKVQYGCALRQLADARDMIEVPGIGDRPPRTLSRQTLAEFIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R EL +LV Q +LR+ G + L++GIV+TGG+A ++G+ + VFH VR+G Sbjct 301 RMEELYSLV-------QAELRRSGFEELLSSGIVITGGSAAMQGMVELGEEVFHMPVRMG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P L D P Y+T +GLL G E+ + K +S +R+ SW + Sbjct 354 WPRYEGALADVMHNPRYATCMGLLMAGLEAR---GRDAPKLSGSSFKDVFERMKSWFKGN 410 Query 420 F 420 F Sbjct 411 F 411 >gi|88949782|ref|ZP_01152397.1| Cell division protein FtsA [Halorhodospira halophila SL1] gi|88926962|gb|EAR45927.1| Cell division protein FtsA [Halorhodospira halophila SL1] Length=412 Score = 548 bits (1413), Expect = 2e-154, Method: Composition-based stats. Identities = 211/420 (50%), Positives = 293/420 (69%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M++ ++ L+VGL+IGT+KV A+VGE DG + +IGVGS PS G+ KG V +++S V+ Sbjct 1 MVRKSEDSLLVGLDIGTSKVVAIVGEAKEDGELEVIGVGSHPSHGLKKGVVVNIDSTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C+I S Y+ +SG HI N GMV I ++EV Q D+E V+ AK+V Sbjct 61 IQRAIEEAELMAGCEIHSAYVGISGSHIRSLNSHGMVAIRDKEVRQADLERVLDGAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LHVIPQE+ ID QEGI++P+G++GVR++A+VH++T A NI K V RC L Sbjct 121 IPADQQILHVIPQEFVIDSQEGIRDPLGMAGVRLEARVHMVTGAVSAADNITKCVRRCQL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 VD ++ LA+S++VL++DE+ELGVC+VDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 DVDDIVLQQLAASHAVLSDDEKELGVCLVDIGGGTTDIAVFTGGAIRHTAVIPIAGHQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKVR+ CAL + +ES+EVPSVG RPPR L RQ+LA V+EPR Sbjct 241 NDIAVALRTPTHHAEDIKVRYACALSQLANPEESIEVPSVGDRPPRRLSRQSLASVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV E LR+ G + + AGIVLTGG++++EG+ A+ VFH VRIG Sbjct 301 YEELLALVQSE-------LRKSGFEDLIPAGIVLTGGSSKMEGVTDLAEEVFHLPVRIGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +TGL+D + P YST VGLL +G + +G + + + + R+ +W + F Sbjct 354 PKFVTGLSDVVRNPMYSTGVGLLAFGARNRDSGMSPALAQDAG-MSALWGRMKNWFKGNF 412 >gi|9656971|gb|AAF95541.1| Gene info cell division protein FtsA [Vibrio cholerae O1 biovar eltor str. N16961] gi|15642395|ref|NP_232028.1| Gene info cell division protein [Vibrio cholerae O1 biovar eltor str. N16961] gi|75829632|ref|ZP_00758929.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae MO10] gi|75827665|ref|ZP_00757100.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae O395] gi|75818129|ref|ZP_00748341.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae V51] gi|75816053|ref|ZP_00746536.1| COG0849: Actin-like ATPase involved in cell division [Vibrio cholerae V52] Length=420 Score = 548 bits (1413), Expect = 2e-154, Method: Composition-based stats. Identities = 289/420 (68%), Positives = 361/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLITCHNDMA+NI+KAVERCGL Sbjct 121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTEL+ LVN+ + +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF QVR+G Sbjct 301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++ S+ WI RL +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420 >gi|75853564|ref|ZP_00761381.1| COG0849: Actin-like ATPase involved in cell division [Vibrio sp. Ex25] Length=420 Score = 547 bits (1412), Expect = 3e-154, Method: Composition-based stats. Identities = 286/420 (68%), Positives = 359/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D ++VGL+IGTA V+ALVGEVLPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADDNIIVGLDIGTATVSALVGEVLPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISRVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR++G+KHHLAAG+VLTGGAAQ++G+ CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIDSVQAKLREEGIKHHLAAGVVLTGGAAQMDGVIECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + +SV + +L +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDMQSSDDSDYNEPKRSSVTGFFDKLRNWIQKEF 420 >gi|53757202|gb|AAU91493.1| Gene info cell division protein FtsA [Methylococcus capsulatus str. Bath] gi|53803441|ref|YP_114838.1| Gene info cell division protein FtsA [Methylococcus capsulatus str. Bath] Length=411 Score = 546 bits (1408), Expect = 7e-154, Method: Composition-based stats. Identities = 202/420 (48%), Positives = 296/420 (70%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +D+ ++VGL+IGT+KVA LVGEV DG + ++G+G+ PSRG+ KG V +LE+ V Sbjct 1 MGKKSDKNVIVGLDIGTSKVACLVGEVNEDGQIEVVGLGTHPSRGLKKGVVVNLETTVHS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA +I SVY ++G HIS N G+V I ++EVTQ DV+ V+ +A++V Sbjct 61 IQRAVEEAELMAGFRIHSVYAGIAGSHISSMNSHGIVAIRDKEVTQGDVDRVIDSARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEG+K P+G+SG+R++A+VH++T A+NI K ++RCGL Sbjct 121 IPADQKILHILPQEFVIDRQEGVKEPIGMSGIRLEARVHIVTGAVSAAQNIQKCIQRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD ++ LASS +VLT+DE+ELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ VT Sbjct 181 EVDDIVLEQLASSQAVLTDDEKELGVCLVDIGGGTTDIAVFTDGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEA+K++H CAL + ++++EVPS+G RP R + R LAE++EPR Sbjct 241 NDIAVALRTPTPHAEALKLKHACALTQLADIEDTIEVPSIGDRPSRQISRLNLAEIVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL LV Q +LR+ G +AAGIVL+GG++++EGL A+ +FH VR+G Sbjct 301 YEELLLLV-------QAELRRAGFDDLIAAGIVLSGGSSRVEGLVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++GL D + P Y+T VGLL +G++ +GE + S R+ +W + F Sbjct 354 PYTVSGLNDVIRNPAYATGVGLLLHGRQHLFSGERPLLGG--GGFRSIWLRMKNWFQGNF 411 >gi|28805446|dbj|BAC58726.1| Gene info cell division protein FtsA [Vibrio parahaemolyticus RIMD 2210633] gi|28897237|ref|NP_796842.1| Gene info cell division protein [Vibrio parahaemolyticus RIMD 2210633] Length=420 Score = 546 bits (1408), Expect = 8e-154, Method: Composition-based stats. Identities = 286/420 (68%), Positives = 359/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKAADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISRVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+QL+F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQLVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR++G+KHHLAAG+VLTGGAAQI+G+ CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIDSVQAKLREEGIKHHLAAGVVLTGGAAQIDGVVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + +SV + +L +W++KEF Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDMQSSDDSDYNEPKRSSVTGFFDKLRNWIQKEF 420 >gi|83648518|ref|YP_436953.1| Gene info cell division protein FtsA [Hahella chejuensis KCTC 2396] gi|83636561|gb|ABC32528.1| Gene info cell division protein FtsA [Hahella chejuensis KCTC 2396] Length=410 Score = 545 bits (1406), Expect = 1e-153, Method: Composition-based stats. Identities = 207/419 (49%), Positives = 292/419 (69%), Gaps = 9/419 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + ++ ++VGL+IGT+KV A+VG+ +G + ++G+GS PSRG+ +G V ++E+ V+ + Sbjct 1 MASSSGNMIVGLDIGTSKVVAIVGQRNQEGAIEVVGIGSHPSRGLKRGVVVNIETTVQAI 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 QRA+++AELMA C+I SVY ++G HI N G+V + + EV Q D+E V+ A++V + Sbjct 61 QRAVEEAELMAGCRIHSVYAGIAGSHIRSMNSHGIVAVRDREVVQADLERVLDAAQAVAI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + RVLHV+PQEY ID QEG+K PVG+SGVR++AKVHL+TC + +NI K V+RCGL+ Sbjct 121 PADQRVLHVVPQEYVIDNQEGVKEPVGMSGVRLEAKVHLVTCAVNAYQNIEKCVKRCGLE 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 VD++I LASSY+VLT+DE+ELGVCVVDIGGGT DIA++TGG++RHT VIP AG+ VT+ Sbjct 181 VDEIILEQLASSYAVLTDDEKELGVCVVDIGGGTTDIAIFTGGSIRHTAVIPIAGDQVTN 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA A TP +AE IK+++ CAL + G DE+++VP VG RP R L RQ+LAEV+EPRY Sbjct 241 DIAMALRTPTQNAEEIKIKYACALTQLAGADETIKVPGVGDRPSRDLSRQSLAEVVEPRY 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 EL L+ E LR+ G + +AAG+VLTGG + +EG+ A+ +FH VR+ P Sbjct 301 EELFTLIQSE-------LRRSGYEDLIAAGVVLTGGTSSMEGVVELAEEIFHMPVRLAVP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +TGL+D P YSTAVGLL YG + G + A + +RL +W F Sbjct 354 QWVTGLSDVVSNPMYSTAVGLLLYGFKQQELGRGAQHRGEPA--ENLFQRLKNWFMGNF 410 >gi|78368229|ref|ZP_00838470.1| Cell division protein FtsA [Shewanella sp. PV-4] gi|78359686|gb|EAP01540.1| Cell division protein FtsA [Shewanella sp. PV-4] Length=411 Score = 545 bits (1405), Expect = 2e-153, Method: Composition-based stats. Identities = 251/420 (59%), Positives = 323/420 (76%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++++G+GS PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGSHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ++SVYL +SGKHI CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVASVYLGISGKHIQCQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+ +AS+ +VLT+DE++LGVC+VD+GGGT DI +YT GALRH V+P AGN VT Sbjct 181 KVDDLVFSAIASADAVLTDDEKDLGVCLVDMGGGTTDITIYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 SDIAKIFRTPLSHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR G++ +AAGIVLTGG A IEG A+ F VR+ Sbjct 301 YQELFELVRKE-------LRDCGLEDQVAAGIVLTGGTASIEGAVDVAEATFGMPVRVAE 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLFEYVNQPIYSTGVGLLHYGARRVL--ERQFERPERQGVTSLWNRVQSWFKGEF 411 >gi|29540760|gb|AAO89704.1| Gene info cell division protein FtsA [Coxiella burnetii RSA 493] gi|29653498|ref|NP_819190.1| Gene info cell division protein FtsA [Coxiella burnetii RSA 493] Length=410 Score = 543 bits (1402), Expect = 4e-153, Method: Composition-based stats. Identities = 200/420 (47%), Positives = 281/420 (66%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D+ L+V L+IGT+K+AALVGEV D + +IG G+ PSRG+ +G V ++ES V+ Sbjct 1 MPKNPDKNLIVALDIGTSKIAALVGEVAQDNQIEVIGFGTHPSRGLKRGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C I S Y ++G HI N G+V I + EV Q DV+ V+ AK+V Sbjct 61 IQRAIEEAELMAGCDIHSAYTGIAGSHIRSLNSHGIVAIRDREVNQSDVDRVIDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEG++ PVG+SGVR++AKVH++T A+NI K V RCGL Sbjct 121 IPADQKILHILPQEFIIDNQEGVREPVGMSGVRLEAKVHIVTGAVSAAQNINKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V ++ LASS++VLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 QVGDIVLEQLASSHAVLTDDEKELGVCMVDIGGGTTDIAIFTEGAIRHTHVIPIAGDHVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +D+A A TP AE IK+++ L V +E+++VPSV RPP+ +Q++ LA+V+ R Sbjct 241 NDVAVALRTPTQYAEQIKIKYASVLPEEVNPEEAIQVPSVAKRPPKQVQKRALAQVVAAR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV E LR+ G + +AAGIVLTGGA+ I G A+R+F VR+G Sbjct 301 YEELFELVLAE-------LRRSGFEDLIAAGIVLTGGASHIAGCIELAERIFQMPVRLGL 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P + GL D P Y+TAVGLL +G +S LN + + S +R+ SW + F Sbjct 354 PQYVNGLADVRDNPIYATAVGLLIHGHQSQLNNRPVFDLQHGMS---LWQRMKSWFQGNF 410 >gi|77384893|gb|ABA76406.1| Gene info Cell division protein FtsA [Pseudomonas fluorescens PfO-1] gi|77460890|ref|YP_350397.1| Gene info Cell division protein FtsA [Pseudomonas fluorescens PfO-1] Length=419 Score = 543 bits (1401), Expect = 5e-153, Method: Composition-based stats. Identities = 208/426 (48%), Positives = 289/426 (67%), Gaps = 13/426 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVADDGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSAADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTSKMEGATELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS------WIKRLNS 414 P + GL D + P YST VGLL YG + +G + S + + RL Sbjct 354 PHGVKGLDDVVRNPIYSTGVGLLMYGLQKQSDGISFSGIGSRDSYSNDEPQAPLLDRLKK 413 Query 415 WLRKEF 420 W++ F Sbjct 414 WVQGNF 419 >gi|37197542|dbj|BAC93381.1| Gene info cell division protein FtsA [Vibrio vulnificus YJ016] gi|37678801|ref|NP_933410.1| Gene info cell division protein [Vibrio vulnificus YJ016] Length=445 Score = 543 bits (1400), Expect = 6e-153, Method: Composition-based stats. Identities = 284/420 (67%), Positives = 357/420 (85%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 26 MTKTADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 85 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+CQIS+V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 86 VQRAIDQAEMMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 145 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 146 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 205 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+Q++F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 206 KVEQIVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 265 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 266 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 325 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR+ G+KHHLAAG+VLTGGAAQIEGL CA+RVF QVR+G Sbjct 326 YSELMGLVNQTIESVQMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGK 385 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL ++GLTDY +EPY+STAVGLLHY ++ + +++ + ++V +L +W++KEF Sbjct 386 PLEVSGLTDYVKEPYHSTAVGLLHYARDMRSSDDSDYNEPKRSAVTGLFGKLRNWIQKEF 445 >gi|67156140|ref|ZP_00417766.1| Cell division protein FtsA [Azotobacter vinelandii AvOP] gi|67086470|gb|EAM05939.1| Cell division protein FtsA [Azotobacter vinelandii AvOP] Length=415 Score = 542 bits (1398), Expect = 1e-152, Method: Composition-based stats. Identities = 207/422 (49%), Positives = 286/422 (67%), Gaps = 9/422 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+GS PSRG+ KG V ++ES V+ Sbjct 1 MASAQSGKMIVGLDIGTSKVVALVGEVTADGQLEIVGIGSHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA CQI S ++ L+G HI N G+V I + EV+Q D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCQIHSAFVGLAGNHIRSLNSHGIVAIRDREVSQADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+N+ K V RC L Sbjct 121 IPSDQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNVEKCVRRCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+++VLTEDERELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAHAVLTEDERELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E++ VPSVG RP R L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLTGAGETINVPSVGERPSRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +L++ E L++ G + + AG+VLTGG+A++EG A+ +FH VR+G Sbjct 301 YDELFSLIHAE-------LQRSGYEDLIPAGVVLTGGSAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSW--IKRLNSWLRK 418 P ++ G+ D P YST VGLL YG + G ++RL W + Sbjct 354 PHSVRGMDDVIGNPIYSTGVGLLLYGLQKQTEGTPVSGTSSYGEETKIPVLERLKRWFQG 413 Query 419 EF 420 F Sbjct 414 NF 415 >gi|68346679|gb|AAY94285.1| Gene info cell division protein FtsA [Pseudomonas fluorescens Pf-5] gi|70732380|ref|YP_262136.1| Gene info cell division protein FtsA [Pseudomonas fluorescens Pf-5] Length=419 Score = 541 bits (1397), Expect = 1e-152, Method: Composition-based stats. Identities = 207/426 (48%), Positives = 292/426 (68%), Gaps = 13/426 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT D+A++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDMAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTSKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS------WIKRLNS 414 P ++ GL+D + P YST VGLL YG + +G + S S + R+ S Sbjct 354 PHSVKGLSDVVRNPIYSTGVGLLLYGLQKQSDGISFSGIGSRDSYSSDEPKAALLDRIKS 413 Query 415 WLRKEF 420 W++ F Sbjct 414 WVQGNF 419 >gi|88811833|ref|ZP_01127086.1| Cell division protein FtsA [Nitrococcus mobilis Nb-231] gi|88790717|gb|EAR21831.1| Cell division protein FtsA [Nitrococcus mobilis Nb-231] Length=412 Score = 541 bits (1397), Expect = 1e-152, Method: Composition-based stats. Identities = 213/419 (50%), Positives = 293/419 (69%), Gaps = 8/419 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT+KVAA+VGE P G V ++G+GS PSRG+ KG V ++ES V+ Sbjct 1 MTKKQERSLLVGLDIGTSKVAAIVGETKPAGEVEVVGIGSHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA CQI SVY +SG H+ N G+V I ++EVT DVE V+ A++V Sbjct 61 IQRAVEEAELMAGCQIHSVYAGISGSHVRSLNSHGIVAIRDKEVTAGDVERVIDAARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +++H++PQE+ ID QEGI+ P+G+SGVR++AKVH++T A+NI+K V RCGL Sbjct 121 IPADQKIIHILPQEFLIDSQEGIREPIGMSGVRLEAKVHMVTGAVSAAQNIIKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 + D +I LASS SVLT+DE+ELGVC+VDIGGGT D+AV+T GA+RHT VIP AG+ VT Sbjct 181 EADDIILQQLASSQSVLTDDEKELGVCLVDIGGGTTDVAVFTDGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IKVR+ CAL + +E++EVPSV RPPR L RQTLAEV+EPR Sbjct 241 NDIAVALRTPTQYAEEIKVRYACALSQLASAEETIEVPSVADRPPRRLSRQTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL++LV Q +LR+ G + +AAGIVLTGG+A++EG+ A+ VFH VR+G Sbjct 301 YEELMSLV-------QAELRRSGFEDLIAAGIVLTGGSAKMEGVIDLAEEVFHMPVRLGM 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P + TGL+D P Y+T +GLL +G S + E+ + +R+ W + Sbjct 354 PKHATGLSDVVCNPVYATGLGLLLFGSNSRGSHRMELNAA-DGGIAGLWQRMKGWFQGN 411 >gi|59712804|ref|YP_205580.1| Gene info cell division protein [Vibrio fischeri ES114] gi|59480905|gb|AAW86692.1| Gene info cell division protein FtsA [Vibrio fischeri ES114] Length=420 Score = 540 bits (1393), Expect = 4e-152, Method: Composition-based stats. Identities = 288/420 (68%), Positives = 356/420 (84%), Gaps = 0/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + ++VGL+IGT KV+ALVGEVLPDG V++IG GSCPSRGMDKGGVNDLESVVK Sbjct 1 MSKTPEGSIIVGLDIGTNKVSALVGEVLPDGQVSVIGSGSCPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+C I+SV+++LSGKHI+ Q E GM ISEEEVTQ+D+++V+HTAKSV+ Sbjct 61 VQRAIDQAELMAECTITSVFISLSGKHIASQIEKGMGSISEEEVTQDDMDSVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R LHVIPQE++ID Q+GI+NP+GLSG+RM+ VHLITCHNDMA+NIVKAVERCGL Sbjct 121 IGDEQRTLHVIPQEFSIDVQKGIRNPIGLSGMRMEVSVHLITCHNDMARNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+ +IF+GLASS +V+TEDER+LGVCVVDIG GTMDIA++T G+LRH +V+PYAGN VT Sbjct 181 KVEHIIFSGLASSNAVITEDERDLGVCVVDIGAGTMDIAIWTDGSLRHAEVLPYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP +DAE +KV++GCA+ + +DE+V VPSVGGRP RSLQR+ LAEVIEPR Sbjct 241 SDIAYAFGTPFNDAEKLKVKYGCAISEHINRDETVNVPSVGGRPSRSLQRRMLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+ELL LVN+ I+ +Q++LR +G KHHLAAGIVLTGG +QIEGL CA+RVF TQVRIG Sbjct 301 YSELLGLVNQRIVSIQDQLRAEGTKHHLAAGIVLTGGGSQIEGLVDCAERVFQTQVRIGQ 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL +TGLTDY +EPY +TAVGLLHYGKES L+ + + + S + IK+ +W+ KEF Sbjct 361 PLEVTGLTDYVKEPYQATAVGLLHYGKESQLHDDEDYVPSKSQSFTTVIKKFKNWILKEF 420 >gi|71557836|gb|AAZ37047.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. phaseolicola 1448A] gi|71737283|ref|YP_276226.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. phaseolicola 1448A] Length=418 Score = 540 bits (1392), Expect = 5e-152, Method: Composition-based stats. Identities = 209/425 (49%), Positives = 290/425 (68%), Gaps = 12/425 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESH-----LNGEAEVEKRVTASVGSWIKRLNSW 415 P ++ GL D + P YST VGLL YG + L+G + ++R+ W Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLMYGLQKQSDGISLSGMVGNSSYSDETKAPVLERIKRW 413 Query 416 LRKEF 420 ++ F Sbjct 414 VQGNF 418 >gi|71145113|gb|AAZ25586.1| Gene info cell division protein FtsA [Colwellia psychrerythraea 34H] gi|71279373|ref|YP_271109.1| Gene info cell division protein FtsA [Colwellia psychrerythraea 34H] Length=411 Score = 540 bits (1392), Expect = 6e-152, Method: Composition-based stats. Identities = 252/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M KA +RKLVVGL+IGT+K++ VGE+ PD ++IIGVG+ P+RGMDKGGVNDL V++ Sbjct 1 MSKAAERKLVVGLDIGTSKISVAVGEITPDNQLSIIGVGNQPARGMDKGGVNDLNLVIQA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMADCQISS+YL +SGKHISCQNE GMVPI+++EV QEDV+NV+HTA+SV Sbjct 61 IQRAINEAELMADCQISSIYLGISGKHISCQNENGMVPINDKEVIQEDVDNVIHTARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY+ID Q+GIK+P+G+SGVRM+AKVH++TC NDMAKN+VK VERC L Sbjct 121 ISAERRMLHVLPQEYSIDCQDGIKSPIGMSGVRMEAKVHIVTCANDMAKNLVKCVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DE+ELGVCVVD+G GTMDI+V+TGG LRHT VIP AGN VT Sbjct 181 TADQLIFSALASSYAVLTDDEKELGVCVVDMGAGTMDISVFTGGTLRHTAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDI+ F TP S AE IKV++ CAL +V +ES++VPSVGGRP RS+ R TL+EV+EPR Sbjct 241 SDISKIFRTPLSHAEDIKVQYACALKQLVSMEESIDVPSVGGRPARSMSRHTLSEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ +EI R+ G++ +AAG VLTGG A++EG+ A+ +F VRI Sbjct 301 YQELFELIQDEI-------RESGLEDQIAAGYVLTGGTAKMEGVLEFAEEIFQMPVRIAN 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL++ GL +Y +P YST VGLLHYG ++ E + SVG + R+++W + EF Sbjct 354 PLSVQGLKEYVNDPTYSTVVGLLHYGMQA--TSEVNSSAKKRESVGDFWSRIHAWFKGEF 411 >gi|67677010|ref|ZP_00473752.1| Cell division protein FtsA [Chromohalobacter salexigens DSM 3043] gi|67518882|gb|EAM22842.1| Cell division protein FtsA [Chromohalobacter salexigens DSM 3043] Length=423 Score = 540 bits (1392), Expect = 6e-152, Method: Composition-based stats. Identities = 215/423 (50%), Positives = 285/423 (67%), Gaps = 16/423 (3%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 +VVGL+IGT+KV A+VG+ DG + I G+GS PSRGM KG V ++ES V+ +QRA++ Sbjct 8 SNMVVGLDIGTSKVVAIVGQPSDDGSIEIAGIGSHPSRGMKKGVVINIESTVQSIQRAVE 67 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMA C I SVY+ ++G HIS N G+V I E EVT D++ V+ +A++ + + R Sbjct 68 EAELMAGCDIHSVYVGVAGSHISSMNSDGVVAIKEREVTPSDIDRVIDSARARAISEGQR 127 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LHV+PQE+AID QEGI+ P+G+SGVR++A+VHL+T + +NI K V RCGL+VD +I Sbjct 128 ILHVLPQEFAIDNQEGIREPLGMSGVRLEARVHLVTAALNAVQNIEKCVRRCGLEVDDII 187 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASSY+VLTEDERELGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ VT+DIA A Sbjct 188 LEQLASSYAVLTEDERELGVCMVDIGGGTTDIAVFTEGAIRHTAVIPIAGDQVTNDIAMA 247 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP AE IKV++ CAL + DE ++VPSVG RP R L RQ LAEV+EPRY EL Sbjct 248 LRTPTQYAEDIKVKYACALTQLASSDEMIKVPSVGDRPARDLSRQALAEVVEPRYEELFT 307 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV EE LR+ G + +AAG+VLTGG +++EG+ A+ +FH VRI P N+ G Sbjct 308 LVREE-------LRRSGYEDLVAAGVVLTGGTSRMEGVVELAEEIFHMPVRIAYPHNVRG 360 Query 367 LTDYAQEPYYSTAVGLLHYG---------KESHLNGEAEVEKRVTASVGSWIKRLNSWLR 417 L D + P YST VGLL YG + E +R S ++R+ W + Sbjct 361 LADVVRNPIYSTGVGLLLYGMNDAKRNAVVSAQPRREEAHTRRGHRQERSGLERIKGWFK 420 Query 418 KEF 420 F Sbjct 421 GNF 423 >gi|86148543|ref|ZP_01066830.1| cell division protein [Vibrio sp. MED222] gi|85833689|gb|EAQ51860.1| cell division protein [Vibrio sp. MED222] gi|84394642|ref|ZP_00993335.1| cell division protein FtsA [Vibrio splendidus 12B01] gi|84374735|gb|EAP91689.1| cell division protein FtsA [Vibrio splendidus 12B01] Length=422 Score = 538 bits (1389), Expect = 1e-151, Method: Composition-based stats. Identities = 284/422 (67%), Positives = 354/422 (83%), Gaps = 2/422 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA ++ALVGE+LPDG +NIIG G PSRGMDKGGVNDLESVVK Sbjct 1 MTKTADDNIIVGLDIGTATISALVGEILPDGQINIIGSGQSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMA+CQIS+V+++LSGKHI+ + E GM IS+EEV+Q+D++ +HTAKS++ Sbjct 61 VQRAIDQAELMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQDDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CH+DMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHSDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V+Q++F+GLASS +V+T+DERELGVCVVDIG GTMDI+++TGGALRHT+V YAGN VT Sbjct 181 TVEQIVFSGLASSNAVITDDERELGVCVVDIGAGTMDISIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV HGCAL +V KD+SV VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVNHGCALSELVSKDDSVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 YTEL+ LVN+ I +Q +LR +G+KHHLAAG+VLTGGAAQI+GL CA+RVF QVR+G Sbjct 301 YTELMGLVNQTIDTVQLQLRDEGIKHHLAAGVVLTGGAAQIDGLVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVE--KRVTASVGSWIKRLNSWLRK 418 PL ++GLTDY +EPY+STAVGLLHY ++ ++ E + KR S+ +L +W++K Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDCQISDEGDYSEPKRSAPSMSGLFGKLRNWIQK 420 Query 419 EF 420 EF Sbjct 421 EF 422 >gi|11761338|dbj|BAB19205.1| FtsA [Shewanella violacea] Length=411 Score = 538 bits (1389), Expect = 1e-151, Method: Composition-based stats. Identities = 249/420 (59%), Positives = 319/420 (75%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++++G+G+ SRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGTHQSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL +SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLGISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+ IK P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDSIKGPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+ +AS+ SVLT DE++LGVC+VDIGGGT DI VYT GALRH VIP AGN VT Sbjct 181 KVDDLVFSAIASADSVLTNDEKDLGVCLVDIGGGTTDITVYTNGALRHCAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP + AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 NDIAKIFRTPLAHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR G++ +AAGIVLTGG + IEG A+ F VR+ Sbjct 301 YQELFELVLKE-------LRDSGLEDQVAAGIVLTGGTSSIEGAVDVAEATFGMPVRVAN 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST +GLLHYG E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLFEYVDQPIYSTGIGLLHYGARRLF--ERQFERPERQGVTSLWNRVQSWFKGEF 411 >gi|69951271|ref|ZP_00639012.1| Cell division protein FtsA [Shewanella frigidimarina NCIMB 400] gi|69165035|gb|EAN74065.1| Cell division protein FtsA [Shewanella frigidimarina NCIMB 400] Length=411 Score = 538 bits (1388), Expect = 2e-151, Method: Composition-based stats. Identities = 251/420 (59%), Positives = 325/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT+KVA ++GEVLPDG +++IG+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQERNLIVGLDIGTSKVAVIIGEVLPDGEISVIGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY+ID Q+GIK+P+G+SG+RM+AK H++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYSIDVQDGIKSPIGMSGMRMEAKAHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ SVLT DE++LGVC+VDIGGGT DIAVYT GALRH VIP AGN VT Sbjct 181 KVDDLVFSGIASADSVLTNDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP + AE IKV+ A S V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 SDIAKIFRTPLTHAEQIKVQFASARSSTVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV ++L+ G++ +AAGIVLTGG + I G A+ F VR+ + Sbjct 301 YQELFELV-------LKQLQDSGLEDQIAAGIVLTGGTSSISGAVEIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y +P YST +GLLHYG + E + E+ V S++ R+ SW + EF Sbjct 354 PLPVKGLYEYVDQPIYSTGIGLLHYGARRVI--ERQFERPERQGVTSFLNRVKSWFKGEF 411 >gi|66047325|ref|YP_237166.1| Gene info Cell division protein FtsA [Pseudomonas syringae pv. syringae B728a] gi|63258032|gb|AAY39128.1| Gene info Cell division protein FtsA [Pseudomonas syringae pv. syringae B728a] Length=418 Score = 538 bits (1387), Expect = 2e-151, Method: Composition-based stats. Identities = 209/425 (49%), Positives = 290/425 (68%), Gaps = 12/425 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSSADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESH-----LNGEAEVEKRVTASVGSWIKRLNSW 415 P ++ GL D + P YST VGLL YG + L+G + ++R+ W Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLMYGLQKQSDGISLSGIVGNSSYSDETKAPVLERIKRW 413 Query 416 LRKEF 420 ++ F Sbjct 414 VQGNF 418 >gi|76884621|gb|ABA59302.1| Gene info Cell division protein FtsA [Nitrosococcus oceani ATCC 19707] gi|77166307|ref|YP_344832.1| Gene info Cell division protein FtsA [Nitrosococcus oceani ATCC 19707] Length=411 Score = 537 bits (1386), Expect = 3e-151, Method: Composition-based stats. Identities = 209/420 (49%), Positives = 292/420 (69%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +D+ +VGL+IGT+K+AA+V E P+G + ++G+GS PSRG+ KG V +++S V+ Sbjct 1 MSKRSDKNFIVGLDIGTSKIAAIVAETHPEGEIEVVGIGSHPSRGLKKGVVVNIDSTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AE MA CQI SV+ ++G HI QN G+VPI ++EVT EDVE V+ +A++V Sbjct 61 IQRAVEEAESMAGCQIYSVFTGIAGSHIRSQNSDGVVPIRDKEVTTEDVERVIDSARAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LHV+PQE+ ID QEGI++PVG+SGVR++AKVHL+ A+NI+K + RCGL Sbjct 121 IPADQKILHVLPQEFIIDSQEGIRDPVGMSGVRLEAKVHLVFGAVSAAQNIIKCIRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 + D +I LASSYSVLT+DE+ELGVC+VDIGGGT DIAV+ GGA+RHT VIP AG+ VT Sbjct 181 EADDIILQQLASSYSVLTDDEQELGVCLVDIGGGTTDIAVFVGGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP A+ IK+R+ CAL + DE +EVPSVG RPPR L RQ LA VIEPR Sbjct 241 NDIAVALRTPTQHADDIKLRYACALTQLTHPDEHIEVPSVGDRPPRRLSRQALAGVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y E + + E+L++ G + L AG+VLTGG+A++EG+ A+ VFHT VR+G Sbjct 301 YR-------ELLELVMEELQRSGYEELLGAGVVLTGGSAKMEGVMELAEEVFHTPVRLGI 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++ GL D + P ++T +GLL +G H + R SV R+ W + F Sbjct 354 PQHMAGLPDVVRNPVHATGIGLLLFG--HHHPYTPGLGGRPLRSVRGVWDRMRGWFQGNF 411 >gi|28871539|ref|NP_794158.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. tomato str. DC3000] gi|28854790|gb|AAO57853.1| Gene info cell division protein FtsA [Pseudomonas syringae pv. tomato str. DC3000] Length=418 Score = 537 bits (1386), Expect = 3e-151, Method: Composition-based stats. Identities = 209/425 (49%), Positives = 290/425 (68%), Gaps = 12/425 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANVQSGKMIVGLDIGTSKVVALVGEVAADGSLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAIEEAQLMAGCRIHSAFVGVAGSHIRSLNSHGIVAIRDREVSAADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLIPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESH-----LNGEAEVEKRVTASVGSWIKRLNSW 415 P ++ GL D + P YST VGLL YG + L+G + ++R+ W Sbjct 354 PHSVKGLADVVRNPIYSTGVGLLLYGLQKQSDGISLSGIVGNSSYSDETKAPVLERIKRW 413 Query 416 LRKEF 420 ++ F Sbjct 414 VQGNF 418 >gi|26988075|ref|NP_743500.1| Gene info cell division protein FtsA [Pseudomonas putida KT2440] gi|24982799|gb|AAN66964.1| Gene info cell division protein FtsA [Pseudomonas putida KT2440] Length=443 Score = 536 bits (1383), Expect = 6e-151, Method: Composition-based stats. Identities = 207/427 (48%), Positives = 287/427 (67%), Gaps = 14/427 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 24 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 83 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 84 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 143 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 144 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 203 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 204 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 263 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 264 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 323 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 324 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 376 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA-------EVEKRVTASVGSWIKRLN 413 P ++ GL+D + P YST VGLL YG A ++R Sbjct 377 PHSVRGLSDVVRNPIYSTGVGLLTYGLLKQSEDLALTGNSNSSSNSYGDEPKAPVLERFK 436 Query 414 SWLRKEF 420 W++ F Sbjct 437 KWVQGNF 443 >gi|24375701|ref|NP_719744.1| Gene info cell division protein FtsA [Shewanella oneidensis MR-1] gi|24350633|gb|AAN57188.1| Gene info cell division protein FtsA [Shewanella oneidensis MR-1] gi|78691050|ref|ZP_00855682.1| Cell division protein FtsA [Shewanella sp. MR-7] gi|78509574|gb|EAP22964.1| Cell division protein FtsA [Shewanella sp. MR-7] Length=411 Score = 536 bits (1382), Expect = 8e-151, Method: Composition-based stats. Identities = 255/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL + GL +Y + YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPVKGLYEYVDQSIYSTGVGLLHYGARRVL--ERQFERPERQGVTSAWNRVQSWFKGEF 411 >gi|82742141|ref|ZP_00904843.1| Cell division protein FtsA [Shewanella sp. W3-18-1] gi|82720475|gb|EAP55339.1| Cell division protein FtsA [Shewanella sp. W3-18-1] Length=411 Score = 536 bits (1382), Expect = 8e-151, Method: Composition-based stats. Identities = 256/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL I GL +Y + YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PLPIKGLYEYVDQSIYSTGVGLLHYGARRVL--ERQFERPERQGVTSAWNRVQSWFKGEF 411 >gi|9950640|gb|AAG07796.1| Gene info cell division protein FtsA [Pseudomonas aeruginosa PAO1] gi|15599604|ref|NP_253098.1| Gene info cell division protein FtsA [Pseudomonas aeruginosa PAO1] gi|46164864|ref|ZP_00137896.2| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa UCBPP-PA14] gi|6715614|gb|AAA95992.2| FtsA [Pseudomonas aeruginosa] gi|12644662|sp|P47203|FTSA_PSEAE Cell division protein ftsA gi|84323060|ref|ZP_00971137.1| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa 2192] gi|84317039|ref|ZP_00965496.1| COG0849: Actin-like ATPase involved in cell division [Pseudomonas aeruginosa C3719] Length=417 Score = 535 bits (1380), Expect = 1e-150, Method: Composition-based stats. Identities = 207/424 (48%), Positives = 286/424 (67%), Gaps = 11/424 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K++VGL+IGT+KV ALVGEV DG + ++G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MASVQSGKMIVGLDIGTSKVVALVGEVTADGQLEVVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID+A+ MA C+I S ++ ++G HI N G+V I + EV D+E V+ A++V Sbjct 61 IQRAIDEAQQMAGCRIHSAFVGIAGNHIRSLNSHGIVAIRDREVNPADIERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH + Q+Y ID QEG++ P+G+SGVR++AKVH++TC + ++NI K V RCGL Sbjct 121 IPADQRVLHTLAQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNASQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LAS+YSVLTEDE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASAYSVLTEDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV Q +LR+ G + + AGIVLTGG +++EG A+ +FH VR+G Sbjct 301 YDELFTLV-------QAELRRSGYEDLIPAGIVLTGGTSKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLN----GEAEVEKRVTASVGSWIKRLNSWL 416 P ++ GLTD + P YST VGLL YG + + + ++RL W+ Sbjct 354 PYSVKGLTDVVRNPIYSTGVGLLMYGLQKQSDGMSMSVSGSSYSSDEPKAPVLERLKRWV 413 Query 417 RKEF 420 + F Sbjct 414 QGNF 417 >gi|68547969|ref|ZP_00587491.1| Cell division protein FtsA [Shewanella amazonensis SB2B] gi|68514300|gb|EAN38039.1| Cell division protein FtsA [Shewanella amazonensis SB2B] Length=411 Score = 535 bits (1379), Expect = 2e-150, Method: Composition-based stats. Identities = 254/420 (60%), Positives = 327/420 (77%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGTAKVAA++GEV+PDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTAKVAAIIGEVMPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVY+++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYMSISGKHIACQNERGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID QEGI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQEGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DI VYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTNDEKDLGVCLVDIGGGTTDITVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV++ A ++V +++S+EVPSVGGRP R++ R TLAEV+EPR Sbjct 241 NDIAKIFRTPLSHAEQIKVQYASARSAMVSREDSIEVPSVGGRPSRTMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E LR ++ +AAGIVLTGG A IEG A+ VF VR+ + Sbjct 301 YQELFELVLKE-------LRSARLEDQIAAGIVLTGGTASIEGAVDVAEAVFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ + GL +Y +P YST VGLLHYG L E + E+ V S R+ SW + EF Sbjct 354 PMPVKGLYEYVDQPIYSTGVGLLHYGARRVL--ERQYERPQRQGVTSVWNRVQSWFKGEF 411 >gi|34499794|ref|NP_904009.1| Gene info cell division protein ftsA [Chromobacterium violaceum ATCC 12472] gi|34105644|gb|AAQ61998.1| Gene info cell division protein ftsA [Chromobacterium violaceum ATCC 12472] Length=404 Score = 534 bits (1377), Expect = 3e-150, Method: Composition-based stats. Identities = 199/412 (48%), Positives = 286/412 (69%), Gaps = 8/412 (1%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL+IGT+K+ A+V EVL DG +NI+G+G PSRG+ +G V ++ES V+ +QRA+++A Sbjct 1 MLVGLDIGTSKIVAIVAEVLEDGQLNIVGMGHTPSRGLKRGMVVNIESTVQAIQRALEEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMADC+I V++ ++G HI N GMV I + EVT+ D++ V+ TA++V + +H+VL Sbjct 61 ELMADCKIHEVFVGIAGSHIKSVNSHGMVAIKDREVTKMDIDRVIETARAVTIPPDHQVL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++ QEY+ID QEG++ P+G+SGVR++AKVH++T A+N+ K V RCGL+V L+ Sbjct 121 HILTQEYSIDGQEGVREPLGMSGVRLEAKVHIVTGAVSAAQNVTKCVRRCGLEVSDLVLQ 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 +AS+ +VL+EDE++LGVC++DIGGGT DIAVY GGA+RHT VIP AG+ +T+DIA A Sbjct 181 PMASAIAVLSEDEKDLGVCLIDIGGGTTDIAVYVGGAIRHTAVIPIAGDQITNDIAMALR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP +AE IK++HG L + + +EVP VG R PR + R TLAEVIEPR EL LV Sbjct 241 TPTKEAEDIKIQHGVGLVGMADPAQMIEVPGVGERGPRQMSRATLAEVIEPRVEELFQLV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +E LR+ G + L++G+VLTGGA+ + G+ A+ VFH VR+G P + GL Sbjct 301 QQE-------LRRSGFEEMLSSGMVLTGGASLMPGMVELAEEVFHLPVRVGVPKYVGGLA 353 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + + P +ST VGLL YGK+ + G A K +A VG R+ +W F Sbjct 354 EVVKTPRFSTGVGLLLYGKD-QIQGYAGPVKAESAGVGQMFSRMKAWFGSNF 404 >gi|77955512|ref|ZP_00819874.1| Cell division protein FtsA [Marinobacter aquaeolei VT8] gi|77865583|gb|EAO96904.1| Cell division protein FtsA [Marinobacter aquaeolei VT8] Length=411 Score = 533 bits (1375), Expect = 5e-150, Method: Composition-based stats. Identities = 206/420 (49%), Positives = 292/420 (69%), Gaps = 9/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M ++VGL+IGT+KV A+VG+ DG + ++G+GS PSRG+ +G V ++E+ V+ Sbjct 1 MSSVETENMIVGLDIGTSKVVAIVGKRKMDGTIEVVGIGSHPSRGLKRGVVVNIETTVQA 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++G HI N G+V I + EVTQ D++ V+ A++V Sbjct 61 IQRAVEEAELMAGCRIHSVYAGIAGSHIKSLNSHGIVAIRDREVTQADIDRVIDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID QEGIK P+G+SGVR++AKVHL+TC + A+NI K V+RCGL Sbjct 121 IPADQKILHILPQEFVIDNQEGIKEPMGMSGVRLEAKVHLVTCAVNAAQNIEKCVKRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +I LASS+++LTEDE+ELGVCVVDIGGGT DIAV+TGGA+RHT VIP AG+ VT Sbjct 181 EVDDIILEQLASSHAILTEDEKELGVCVVDIGGGTTDIAVFTGGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP +AE IK+++ CAL + G +E+++VPSVG R PR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQNAEEIKIKYACALTQLAGAEETIKVPSVGDRAPRDLSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV E LR+ G + + AGIV+TGG++ +EG+ A+ +FH VR+ Sbjct 301 YEELFTLVQSE-------LRRSGFEDLIPAGIVITGGSSTMEGVVELAEEIFHMPVRLAC 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++G+T+ P Y+T VGLL +G G A V K A S ++R+ +W F Sbjct 354 PQAVSGMTEVVNNPIYATGVGLLIHGFRQMDLGRAPVLKGEEAP--SLVERMKAWFTGHF 411 >gi|25166158|dbj|BAC24349.1| Gene info ftsA [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|32490952|ref|NP_871206.1| Gene info cell division protein [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length=418 Score = 533 bits (1374), Expect = 7e-150, Method: Composition-based stats. Identities = 305/419 (72%), Positives = 374/419 (89%), Gaps = 1/419 (0%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 +KATD+KLVVGLEIGT+KVA LVG++L DG+V IIG G+ PS+G+DKGGVNDLE+VV+CV Sbjct 1 MKATDKKLVVGLEIGTSKVAVLVGDILQDGIVKIIGYGNYPSKGIDKGGVNDLEAVVQCV 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 Q++I+QAEL ++C I SVYLALSGKHISCQNEIG+VPI EEEVTQEDVENVVHTAKSVR+ Sbjct 61 QQSINQAELTSECNIKSVYLALSGKHISCQNEIGIVPIPEEEVTQEDVENVVHTAKSVRI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 ++EHR+LHVIPQEY IDYQEGIKNP+GLSG+RMQA VHLITCHN MAKN++KAV RC +K Sbjct 121 KNEHRILHVIPQEYTIDYQEGIKNPIGLSGIRMQASVHLITCHNGMAKNMIKAVRRCDVK 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 VDQ+IF+GLASSY+VLTEDE+ELGVCVVDIGGGTMDIA+YT GALRHTKVIPYAGNVVT Sbjct 181 VDQVIFSGLASSYAVLTEDEKELGVCVVDIGGGTMDIAIYTAGALRHTKVIPYAGNVVTR 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIAYAFGTPP +AE+IK+ +GCALGS+V K+E++E+ S+GGRP R LQRQTL+EVIEPRY Sbjct 241 DIAYAFGTPPIEAESIKINYGCALGSLVKKEENIEIASLGGRPSRILQRQTLSEVIEPRY 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 ELLNLV +E+ +LQ++L+ + +KHHL+AGIVLTGGA+QI G+ +CAQ++F+TQVRIG P Sbjct 301 IELLNLVKKEVCKLQKQLKSESIKHHLSAGIVLTGGASQINGIISCAQKIFNTQVRIGEP 360 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 LN+TGL DY+ PYY+TAVGLLHYGKE LN E E ++ + +WIK+ ++W++KEF Sbjct 361 LNVTGLIDYSNHPYYATAVGLLHYGKEYFLNKEIESMEK-NNFIENWIKKFSNWIKKEF 418 >gi|48861175|ref|ZP_00315079.1| COG0849: Actin-like ATPase involved in cell division [Microbulbifer degradans 2-40] Length=409 Score = 533 bits (1374), Expect = 7e-150, Method: Composition-based stats. Identities = 212/420 (50%), Positives = 291/420 (69%), Gaps = 11/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV A+VGE+ +G ++I+G+GS S G+ KG V ++ES V+ Sbjct 1 MANANGGKMIVGLDIGTSKVVAIVGEISAEGELSIVGIGSHKSVGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELMA C I SVY ++G HI N G+V I + EV +D++ V+ A++V Sbjct 61 IQRAIEEAELMAGCSIHSVYAGIAGNHIRSLNSHGIVAIKDREVFAQDLDRVIDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + R+LH++PQEY ID QEG+K P+G+SGVR++AKVHL+TC + ++NI K + RCGL Sbjct 121 IPADQRILHILPQEYLIDEQEGVKEPLGMSGVRLEAKVHLVTCAVNASQNIEKCIRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V+ +I LASSY+VLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EVEDIILEQLASSYAVLTDDEKELGVCMVDIGGGTTDIAIFTEGAIRHTGVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+++ CAL + G +E+++VPSVG RP R L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIKYACALAKLTGAEETIKVPSVGDRPARDLSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV Q +LR+ G + +AAGIVLTGG +++EG+ A+ +FH VR+GA Sbjct 301 YDELFTLV-------QAELRRSGFEDMVAAGIVLTGGTSKMEGVVDLAEEIFHMPVRLGA 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P + GL D P YST VGLL YG E A T S S + RL SW ++ F Sbjct 354 PQGVKGLKDIVTNPIYSTGVGLLLYGAEQQKGERAHS----TPSGESAVSRLKSWFQRNF 409 >gi|82738698|ref|ZP_00901525.1| Cell division protein FtsA [Pseudomonas putida F1] gi|82714264|gb|EAP49351.1| Cell division protein FtsA [Pseudomonas putida F1] Length=420 Score = 531 bits (1371), Expect = 1e-149, Method: Composition-based stats. Identities = 207/427 (48%), Positives = 287/427 (67%), Gaps = 14/427 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYACALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA-------EVEKRVTASVGSWIKRLN 413 P ++ GL+D + P YST VGLL YG A ++R Sbjct 354 PHSVRGLSDVVRNPIYSTGVGLLTYGLLKQSEDLALTGNSNSSSNSYGDEPKAPVLERFK 413 Query 414 SWLRKEF 420 W++ F Sbjct 414 KWVQGNF 420 >gi|89093035|ref|ZP_01165986.1| cell division protein FtsA [Oceanospirillum sp. MED92] gi|89082685|gb|EAR61906.1| cell division protein FtsA [Oceanospirillum sp. MED92] Length=431 Score = 531 bits (1370), Expect = 2e-149, Method: Composition-based stats. Identities = 204/415 (49%), Positives = 286/415 (68%), Gaps = 8/415 (1%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++V L+IGT+KV LVGE+ DG ++I+G+GS PSRG+ KG V ++ES V +QRA++ Sbjct 24 SNMIVALDIGTSKVVCLVGEINVDGSIDIVGIGSHPSRGLKKGVVVNIESTVSSIQRAVE 83 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMA C+I SV + ++G HI+ N G+V + + EVT D+E V+ A++V + + + Sbjct 84 EAELMAGCKIHSVTVGIAGSHINSLNSHGIVAVRDREVTDYDLERVIDAARAVAIPADQK 143 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++PQEY ID EGI+ P+G+SGVR++AKVHL+T + A+NI K V RCGL+VD L+ Sbjct 144 ILHILPQEYEIDNSEGIREPLGMSGVRLEAKVHLVTGSVNAAQNIEKCVRRCGLEVDHLV 203 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASSYSVLTEDE+ELGVC+VDIGGGT DI+++TGGA+RHT VIP AG+ VT+DIA A Sbjct 204 LEQLASSYSVLTEDEKELGVCMVDIGGGTSDISIFTGGAIRHTAVIPIAGDQVTNDIAMA 263 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP AE IK+++ CAL + G DE++ VP VG RP R+L RQ LAEV+EPRY EL N Sbjct 264 LRTPMQHAEDIKIKYACALAQLAGPDETIMVPGVGDRPSRTLSRQALAEVVEPRYEELFN 323 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q +LR+ G + +AAGIVLTGG +++EG A+ +FH VR+ +P + G Sbjct 324 LV-------QAELRRSGFEDLVAAGIVLTGGTSKMEGAVELAEEIFHMPVRLASPHGVKG 376 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEA-EVEKRVTASVGSWIKRLNSWLRKEF 420 + D P Y+T +GLL Y + N A E+ + S I ++ +W + F Sbjct 377 MEDILGNPIYATGMGLLLYAHDDLGNEPAQEIPEVELVEQVSVINKMKTWFQGNF 431 >gi|2707899|gb|AAB92376.1| FtsA [Pseudomonas putida] Length=420 Score = 531 bits (1369), Expect = 2e-149, Method: Composition-based stats. Identities = 207/427 (48%), Positives = 287/427 (67%), Gaps = 14/427 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M A K++VGL+IGT+KV ALVGEV DG + I+G+G+ PSRG+ KG V ++ES V+ Sbjct 1 MANAHSGKMIVGLDIGTSKVVALVGEVGEDGTLEIVGIGTHPSRGLKKGVVVNIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++A+LMA C+I S ++ ++G HI N G+V I + EV+ D+E V+ A++V Sbjct 61 IQRAVEEAQLMAGCRIHSAFVGVAGNHIRSLNSHGIVAIRDREVSLADLERVLDAAQAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + RVLH +PQ+Y ID QEG++ P+G+SGVR++AKVH++TC + A+NI K V RCGL Sbjct 121 IPADQRVLHTLPQDYVIDNQEGVREPLGMSGVRLEAKVHVVTCAVNAAQNIEKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++D +I LAS+YSVLT+DE+ELGVC+VDIGGGT DIA++T GA+RHT VIP AG+ VT Sbjct 181 EIDDIILEQLASAYSVLTDDEKELGVCLVDIGGGTTDIAIFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AE IK+R+ CAL + G E+++VPSVG RPPR L RQ LAEV+EPR Sbjct 241 NDIAMALRTPTQYAEEIKIRYTCALAKLAGAGETIKVPSVGDRPPRELSRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL L+ Q +LR+ G + + AGIVLTGG A++EG A+ +FH VR+G Sbjct 301 YDELFTLI-------QAELRRSGYEDLVPAGIVLTGGTAKMEGAVELAEEIFHMPVRLGV 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA-------EVEKRVTASVGSWIKRLN 413 P ++ GL+D + P YST VGLL YG A ++R Sbjct 354 PHSVRGLSDVVRNPIYSTGVGLLTYGLLKQSEDLALTGNSNSSSNSYGDEPKAPVLERFK 413 Query 414 SWLRKEF 420 W++ F Sbjct 414 KWVQGNF 420 >gi|88799420|ref|ZP_01114997.1| cell division protein FtsA [Reinekea sp. MED297] gi|88777730|gb|EAR08928.1| cell division protein FtsA [Reinekea sp. MED297] Length=410 Score = 529 bits (1365), Expect = 8e-149, Method: Composition-based stats. Identities = 202/420 (48%), Positives = 287/420 (68%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M ++VGL+IGT+KV A+VG V +G + I+G+GS PSRG+ KG V ++ES ++ Sbjct 1 MTSPHKGNMLVGLDIGTSKVVAIVGTVTAEGGLEIVGLGSHPSRGLKKGVVVNIESTIQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI++AELM+ C I SVY+ ++G HIS N G+V I ++EV + D+E V+ AK+V Sbjct 61 IQRAIEEAELMSGCDIHSVYVGIAGSHISSLNSNGIVAIKDKEVVEADLERVIDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHV+PQEY ID QEGIK P+G+ GVR++A+VH++T + +NI K V RCGL Sbjct 121 IPADQNILHVLPQEYIIDSQEGIKEPLGMCGVRLEARVHMVTGAQNAVQNIDKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQ+I LAS+ +VLT+DE+ELGVC+VDIGGGT D+AV+T GA+RHT VIP AG+ VT Sbjct 181 EVDQIILEQLASAQAVLTDDEKELGVCLVDIGGGTTDMAVFTEGAIRHTAVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA AF TP AE IK+++ CAL + G+ E+++VPSVG R R L RQ LAEV+EPR Sbjct 241 NDIAMAFATPTQHAEDIKIKYACALSQLAGEHETIKVPSVGDRSARELTRQALAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +L+ E LR+ G + + AGIVLTGG A++EG A+ VFH VR+ + Sbjct 301 YEELFSLIKAE-------LRRSGFEDMIPAGIVLTGGTAKMEGAVELAEEVFHVPVRLAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P ++GL+D P ++T VGLL YG + +G+ + R S ++ W+ + F Sbjct 354 PQGVSGLSDVVNNPIHATGVGLLQYGLKQLHSGKKTMSSRSKTSAWQSFRK---WIAENF 410 >gi|71796038|gb|AAZ40789.1| Gene info cell division protein [Candidatus Blochmannia pennsylvanicus str. BPEN] gi|71891932|ref|YP_277662.1| Gene info cell division protein [Candidatus Blochmannia pennsylvanicus str. BPEN] Length=418 Score = 524 bits (1351), Expect = 3e-147, Method: Composition-based stats. Identities = 331/420 (78%), Positives = 384/420 (91%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKA+D+KL+VGLEIGTAKVA ++GE+LPDG+VN+IG+G CPSRGMDKGGVN+LESV+KC Sbjct 1 MIKASDKKLLVGLEIGTAKVATMIGEILPDGIVNVIGLGYCPSRGMDKGGVNNLESVIKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQ +I+QAELMA CQISSVYL+LSGKHISC+NEIGMVPISEEEVTQ DV+NVVH AKSVR Sbjct 61 VQYSINQAELMAGCQISSVYLSLSGKHISCKNEIGMVPISEEEVTQSDVDNVVHIAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF+GLASS++VLTEDERELGVCVVD+GGGTMDIA+YT GALRHTKVIPYAGNVVT Sbjct 181 QVDQLIFSGLASSHAVLTEDERELGVCVVDLGGGTMDIAIYTAGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTP SDAE IKVR+GCAL S++ K E++EVPSVGGRPPR LQR LAE+IEPR Sbjct 241 SDIAYAFGTPLSDAEIIKVRYGCALESLISKGENIEVPSVGGRPPRILQRHMLAEIIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL+ LVN+EILQLQ +LRQ +KHHLAAGIVLTGGA+ I+GL+ACAQ+VFHTQVRI + Sbjct 301 YIELMMLVNKEILQLQSQLRQLNIKHHLAAGIVLTGGASLIDGLSACAQKVFHTQVRIAS 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +N G+TD + P+YST +GLLHYGKESHLN E ++EK +T + WI+++N+WL+KEF Sbjct 361 SINTNGVTDDIKRPHYSTVIGLLHYGKESHLNNEVDIEKGIT--IKGWIRKVNNWLKKEF 418 >gi|78363218|gb|ABB41183.1| Gene info cell division protein FtsA [Thiomicrospira crunogena XCL-2] gi|78484932|ref|YP_390857.1| Gene info cell division protein FtsA [Thiomicrospira crunogena XCL-2] Length=417 Score = 522 bits (1346), Expect = 1e-146, Method: Composition-based stats. Identities = 198/419 (47%), Positives = 285/419 (68%), Gaps = 8/419 (1%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 + + +V+GL+IGT+K+AA++G+V DG + ++G+G+ PS+G+ KG V +++S V+ +Q Sbjct 6 QNPNTNVVIGLDIGTSKIAAIIGKVKEDGSIEVVGMGTHPSKGLKKGVVVNIDSTVESIQ 65 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVR 122 RAID+AE M+ + SV + ++G HI N GMV IS +EV +EDV+ V+ A+++ + Sbjct 66 RAIDEAERMSGIKAESVSVGIAGSHIGSFNSNGMVAISNQEVQEEDVQRVIDAAQTIAIP 125 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + VLH++PQE+ ID Q GI+ P+G+SGVR++AKVH++T A+NI K VERC LKV Sbjct 126 GDQEVLHILPQEFMIDNQGGIREPIGMSGVRLEAKVHMVTGSVSAAQNITKCVERCSLKV 185 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 D LI LASS +VL+EDE+ELGVC+VDIGGGT DIA++ GA+RH+ VIP AG+ VT+D Sbjct 186 DNLILEQLASSEAVLSEDEKELGVCLVDIGGGTTDIAIFQNGAIRHSAVIPVAGDQVTND 245 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYT 302 IA A TP AE IK ++ CAL ++ +DE +EVPSVG RP R L R TL EVIEPRY Sbjct 246 IAMALRTPKQAAEDIKKKYACALPQLISQDEEIEVPSVGDRPARCLSRHTLVEVIEPRYE 305 Query 303 ELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPL 362 EL L+ Q +LR+ ++ +AAGIVLTGG++ +EG A+ VFH VR+G P Sbjct 306 ELFQLI-------QAELRRTDFENKIAAGIVLTGGSSLVEGAVELAEEVFHMPVRLGMPH 358 Query 363 NITGLTDYAQEPYYSTAVGLLHYGKESH-LNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +++GL + P ++T VGLL Y KE +E ++ S I+++ SW K F Sbjct 359 DVSGLKEEVCNPSFATTVGLLMYAKEHPGTRFSSEKTSELSLDKESIIEKMKSWFSKNF 417 >gi|56312266|emb|CAI06911.1| Gene info cell division protein FTSA [Azoarcus sp. EbN1] gi|56476223|ref|YP_157812.1| Gene info cell division protein FTSA [Azoarcus sp. EbN1] Length=409 Score = 522 bits (1346), Expect = 1e-146, Method: Composition-based stats. Identities = 196/414 (47%), Positives = 275/414 (66%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV +V E PDG +N+IG+ + P+ G+ +G V ++E+ V + R I Sbjct 6 KDLVVGLDIGTAKVTCMVAESRPDGRLNVIGLATQPTSGLKRGVVVNIEATVDAIARVIQ 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 + E MA+C+I VY ++G HI N GMV I ++EVT DVE V+ A+++ + E + Sbjct 66 EVEQMAECKIRDVYTGIAGSHIKSFNSNGMVAIKDKEVTPLDVERVIEVARAMPIPAEQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID Q G++ P+G+SGV+++ KVH++T A+N++K V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQGGVREPIGMSGVKLEVKVHIVTGAVSAAQNVIKCVRRCGLEVMDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASSY+VLTEDE++LGVC+VDIGGGT DIAV+T GA+RHT V+P AG+ VT+DIA A Sbjct 186 LQPLASSYAVLTEDEKDLGVCLVDIGGGTTDIAVFTHGAIRHTAVLPIAGDQVTNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP S+AE IK+RHG AL ++ +E +EVP VG RPPR L RQ LA+VIEPR +EL Sbjct 246 LRTPTSEAEEIKIRHGVALHTLADPEEMIEVPGVGDRPPRPLSRQRLADVIEPRVSELFE 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q +LR+ G + L++G+VLTGG++ + G+ + VFH VRIG+P G Sbjct 306 LV-------QAELRRSGYEELLSSGVVLTGGSSMMLGMVELGEEVFHMPVRIGSPQYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D +P Y+ A+GL+ G G + R T SV R+ SW K F Sbjct 359 LADVVCQPRYANAMGLVMEGSAQRRRG---MLARETRSVRQVFGRMKSWFEKNF 409 >gi|71550341|ref|ZP_00670466.1| Cell division protein FtsA [Nitrosomonas eutropha C71] gi|71484440|gb|EAO17000.1| Cell division protein FtsA [Nitrosomonas eutropha C71] Length=412 Score = 522 bits (1346), Expect = 1e-146, Method: Composition-based stats. Identities = 198/421 (47%), Positives = 280/421 (66%), Gaps = 10/421 (2%) Query 1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 M K + + ++VGL+IGT+K+ A+V E+ P+G IIG+GS PSRG+ KG V ++E+ V Sbjct 1 MSKVKEGKNMIVGLDIGTSKIVAIVAEIKPEGGFEIIGLGSHPSRGLKKGVVVNIEATVN 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 +QRA+++ ELMA C+IS VY ++G HI N GMV I ++EVTQ DVE V+ TAK+V Sbjct 61 AIQRALEEVELMAGCRISDVYAGIAGNHIKSFNSHGMVAIKDKEVTQADVEKVMETAKAV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + ++LH++ QE+ ID QE ++ PVG+SG+R++ KVH++T A+NI K + RCG Sbjct 121 NIPADQQILHILQQEFIIDGQEDVREPVGMSGIRLEVKVHIVTGAVSAAQNIAKCINRCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L V LI LAS+ +VL+EDE++LGVC+VDIGGGT DIAV+T G++RHT VIP AG+ + Sbjct 181 LDVRDLILQPLASATAVLSEDEKDLGVCLVDIGGGTTDIAVFTDGSIRHTAVIPVAGDQI 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA A TP DAE IK R+G AL ++ E VEVP VG R R L RQTLAEVIEP Sbjct 241 TNDIAMALRTPTKDAEDIKCRYGTALRTLADIREMVEVPDVGNRGVRPLSRQTLAEVIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R EL L+ Q +LR+ G + L++GIV+TGG++ + G+ + +FH VR+G Sbjct 301 RVEELYLLI-------QAELRRSGFEQLLSSGIVITGGSSSMLGMVELGEEIFHMPVRLG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P L + Q P YSTA+GL+ G E HL+ K + S + ++ SW ++ Sbjct 354 LPAYNGSLEEVVQTPRYSTAIGLVMAGMEDHLHHH--QAKLKSGSTRQILAKMKSWFQEN 411 Query 420 F 420 F Sbjct 412 F 412 >gi|71848727|gb|AAZ48223.1| Gene info Cell division protein FtsA [Dechloromonas aromatica RCB] gi|71909106|ref|YP_286693.1| Gene info Cell division protein FtsA [Dechloromonas aromatica RCB] Length=409 Score = 521 bits (1345), Expect = 1e-146, Method: Composition-based stats. Identities = 188/415 (45%), Positives = 270/415 (65%), Gaps = 10/415 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 ++ LVVGL+IGT+K+ ALV E+ +G +N+IG+GS SRG+ KG V ++E V + R I Sbjct 5 NKDLVVGLDIGTSKIVALVAEINNEGNLNVIGMGSQDSRGLKKGVVVNIEDTVHTISRVI 64 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 + ELMADC++S+VY ++G HI N GMV I ++EVT DVE V+ TA+++ + + Sbjct 65 QEVELMADCKVSNVYTGIAGSHIKSFNSNGMVAIKDKEVTPSDVERVIETARAMPIPADQ 124 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 +LH++ QE+ ID Q+GI+ P+G+SG+R++ K H++T A+NIVK V RCGL+V+ L Sbjct 125 EILHILTQEFVIDGQDGIREPIGMSGMRLEVKTHIVTGAVSAAQNIVKCVRRCGLEVNDL 184 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + LASSY+VL+EDE++LGVC++DIGGGT DIAV+T GA+RHT VIP AG+ +T+DIA Sbjct 185 VLQPLASSYAVLSEDEKDLGVCLIDIGGGTTDIAVWTQGAIRHTSVIPIAGDQITNDIAM 244 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 A TP +AE IK ++GCAL + E++EV V RP R L R+ LA+VI+PR EL Sbjct 245 ALRTPTREAEDIKCKYGCALSQLADAAENMEVAGVDDRPSRKLSRRALADVIQPRVEELY 304 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 L+ E LR+ G + L++GIVLTGGA+ + G+ + +FH VR+G P Sbjct 305 ELIQNE-------LRRAGFEEVLSSGIVLTGGASVMPGMVELGEEIFHMPVRLGNPKYTG 357 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D Q P +ST+ GLL + G+ EK+ + SW K F Sbjct 358 SLADVVQSPRFSTSFGLLLEAQAQRKRGQKIQEKQ---GFKDVFDGMKSWFAKNF 409 >gi|85712529|ref|ZP_01043577.1| Cell division ATPase, FtsA [Idiomarina baltica OS145] gi|85693663|gb|EAQ31613.1| Cell division ATPase, FtsA [Idiomarina baltica OS145] Length=410 Score = 519 bits (1340), Expect = 6e-146, Method: Composition-based stats. Identities = 248/420 (59%), Positives = 321/420 (76%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K T+R++VVGL+IGT+KV ALVGE+LPD +++IGVG +RGMDKGGVNDL VV+ Sbjct 1 MSKTTERQMVVGLDIGTSKVTALVGELLPDDDISVIGVGVTTARGMDKGGVNDLNLVVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+D+AELMADC+I+SVYL +SG+HISCQNE GMVP++E EVTQ+DV+NV+H A+SV Sbjct 61 IQRAVDEAELMADCRIASVYLNISGRHISCQNESGMVPVNEAEVTQDDVDNVIHAAQSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEY ID QE I++P+G+SGVRM++KVH+ITC NDMAKNI KAVERCGL Sbjct 121 IAKERRILHVLPQEYVIDSQESIRSPIGMSGVRMESKVHIITCANDMAKNITKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+LIF+ LASS SVLT+DE++LGV +VD+GGGT+DI +Y GG LRHT VIP AGN VT Sbjct 181 QVDKLIFSALASSISVLTDDEKDLGVALVDMGGGTIDICIYAGGVLRHTAVIPAAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP + AE IK H CAL +V ++++EVPSVGGRP R + R TLAEV+EPR Sbjct 241 SDIAKIFRTPTNHAEQIKTEHACALRGLVSMEDTIEVPSVGGRPARMMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV EEI+Q G+ +AAG+VLTGG+A+++G A+ +F VRIG Sbjct 301 YQELFELVREEIVQ-------SGLDEQVAAGVVLTGGSAKMQGCIEFAEEIFQMPVRIGK 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL+I GL DY ++P Y+TAVGLL YG+E A ++ V ++L +W + EF Sbjct 354 PLHIKGLKDYVEDPVYATAVGLLKYGQEDAT---ASQQESSKTDVIGMWQKLQNWFKGEF 410 >gi|68247429|gb|EAN29515.1| Cell division protein FtsA [Magnetococcus sp. MC-1] gi|69256637|ref|ZP_00606131.1| Cell division protein FtsA [Magnetococcus sp. MC-1] Length=412 Score = 519 bits (1340), Expect = 7e-146, Method: Composition-based stats. Identities = 184/419 (43%), Positives = 266/419 (63%), Gaps = 7/419 (1%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + D+ L++GL+IGT K+ +V +V PDG ++IIG+G+ PSRG+ KG V D++S V+ + Sbjct 1 MAKHDQNLIIGLDIGTTKICCIVADVQPDGRLDIIGLGTHPSRGLRKGVVIDIDSTVESI 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 + A+++AE+MA +I VY ++G HI+ N G+V + EV D++ V+ A++ + Sbjct 61 RMAVEEAEMMAGVEIRMVYAGIAGAHIASNNSEGVVATKDNEVHASDIQRVLDAARAQSI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + +LHVIPQE+ +D QEGIK+P+G++GVR++A+VHL+T A+NIVK RCGL Sbjct 121 PMDREILHVIPQEFVLDAQEGIKDPLGMAGVRLEARVHLVTGAVASAQNIVKCANRCGLD 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V +I LAS+ + LTEDE+ELG C++DIGGGT DIA+Y G ++HT V+ G+ +T+ Sbjct 181 VGDIILEQLASAEACLTEDEKELGCCLLDIGGGTTDIAIYAEGHIKHTAVLAIGGDHMTN 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP +AE +K + GCAL ++VG DE++EVPS+G RPPRSL R LAE+IEPR Sbjct 241 DIAVGLRTPTREAEQLKRKFGCALSALVGPDETIEVPSIGERPPRSLGRHILAEIIEPRV 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 EL LV EI+ + G +AAGIVLTGGAA EG+ A+ +F+ VR G P Sbjct 301 EELFTLVQREIV-------RSGFDEQIAAGIVLTGGAANTEGIVDLAEEIFNKPVRRGLP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + GLTD Y+TA GL+ Y + S + R+ SW F Sbjct 354 QGVGGLTDVIANASYATATGLVLYANRYGQESTMRYNQDDVGGSRSMVSRMRSWFGDIF 412 >gi|76876326|emb|CAI87548.1| Gene info Cell division protein [Pseudoalteromonas haloplanktis TAC125] gi|77361415|ref|YP_340990.1| Gene info Cell division protein [Pseudoalteromonas haloplanktis TAC125] Length=410 Score = 517 bits (1333), Expect = 4e-145, Method: Composition-based stats. Identities = 235/420 (55%), Positives = 304/420 (72%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K+ +R LV+GL++GT+KV A VGE+ D ++I+GVG+ SRGMDKGGVNDL V + Sbjct 1 MTKSAERNLVIGLDVGTSKVIATVGEITADNKLSIVGVGTQISRGMDKGGVNDLNLVSES 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++RAID+AELMADC+ISSVYL +SGKHI CQNE G+V I+ EVT ED+ENV+H A+SV Sbjct 61 IRRAIDEAELMADCRISSVYLGISGKHIQCQNESGVVAINNTEVTDEDIENVIHIARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E ++LH +PQEY+ID QEGIKNP+G+SGVRM+A+ H+ITC NDMAKNI K V+RCGL Sbjct 121 ISAERKMLHALPQEYSIDMQEGIKNPLGMSGVRMEARAHIITCSNDMAKNIEKCVQRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF LAS YSVLT+DE+ELGV V+DIGGGTMDI +Y GALRH+ VIP AGN VT Sbjct 181 EVDQLIFTALASCYSVLTDDEKELGVAVLDIGGGTMDITIYINGALRHSAVIPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DIA F TP S AEA+KV++ CA + ++++EVPSVGGRP R + R TL+EV+EPR Sbjct 241 GDIAKIFRTPISHAEALKVQYACASSQMASNEDTIEVPSVGGRPARLMSRHTLSEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 + EL L EEI R+ G++ +AAG+V+TGG A++ G A+ +F VRIG Sbjct 301 FRELFELAMEEI-------RRSGLEDQIAAGLVITGGTAKMAGAMEVAEDIFQMPVRIGK 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ I GLTDY +P Y+TAVGLL YG+ +K + R+ W + EF Sbjct 354 PIGIVGLTDYVDDPSYATAVGLLQYGRTMQ---SMNAQKLKAEGNNNLWSRITKWFQGEF 410 >gi|76794187|ref|ZP_00776661.1| Cell division protein FtsA [Pseudoalteromonas atlantica T6c] gi|76590483|gb|EAO66699.1| Cell division protein FtsA [Pseudoalteromonas atlantica T6c] Length=409 Score = 517 bits (1333), Expect = 4e-145, Method: Composition-based stats. Identities = 246/420 (58%), Positives = 318/420 (75%), Gaps = 11/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K TDRKL+VGL+IGT+ V A+VGE+L DG +++IGVGS PS+GMDKGGVNDL VV+ Sbjct 1 MSKVTDRKLIVGLDIGTSMVKAVVGELLDDGGISVIGVGSHPSKGMDKGGVNDLNLVVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+ + ELMADC++SSV++++SG+H+ CQNE GMVPI+ +EVTQEDV+NV+H A+SV Sbjct 61 VQRAMSEMELMADCRVSSVFMSISGRHVQCQNESGMVPINNKEVTQEDVDNVIHAARSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQE+ ID QEGIKNP+G+SGVRM+A+ H+ITC +DMAKN+VK VERC L Sbjct 121 IAAERRLLHVLPQEFTIDVQEGIKNPIGMSGVRMEAQAHIITCADDMAKNLVKCVERCDL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DE+ELGVCVVDIGGGT+DI +YT GA+RHT V+P AGN +T Sbjct 181 TTDQLIFSSLASSYAVLTDDEKELGVCVVDIGGGTIDIVIYTDGAIRHTAVVPAAGNQIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S AE IK+ + CAL +V +E++EV SVGGRP R++ R TLAEVIEPR Sbjct 241 SDIAKIFRTPISHAEDIKINYACALKDMVSMEENIEVHSVGGRPSRAMSRHTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +EI R G + +AAGIVLTGG A++EG A+ +F VR+G Sbjct 301 YQELFELVQKEI-------RNSGFEEQIAAGIVLTGGTAKMEGAIEFAEEIFQMPVRVGE 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PL+I GL++Y ++P ++TA+GLL YGKE A K +R+ SW + EF Sbjct 354 PLSIKGLSEYVEDPTFATAIGLLQYGKEHITAKTAAKTKAS----EGVWERIQSWFKGEF 409 >gi|68214326|ref|ZP_00566150.1| Cell division protein FtsA [Methylobacillus flagellatus KT] gi|68187257|gb|EAN01947.1| Cell division protein FtsA [Methylobacillus flagellatus KT] Length=412 Score = 516 bits (1332), Expect = 5e-145, Method: Composition-based stats. Identities = 194/418 (46%), Positives = 283/418 (67%), Gaps = 15/418 (3%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D+ L+VGL+IGT+K+ A+V E+ DG + +IG+G SRG+ KG V +++S V+ +QRA+ Sbjct 7 DKNLIVGLDIGTSKIVAIVAELQVDGSLKVIGLGQNTSRGLKKGVVVNIDSTVQAIQRAL 66 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 ++AELMADC+IS+VY ++G HI N GMV I + EVTQ DV+ V+ TA+++ + + Sbjct 67 EEAELMADCKISTVYTGIAGSHIKSLNSHGMVKIKDAEVTQMDVDRVIETARAIALPSDQ 126 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++LH++ QE+ ID QE ++ P+G+SG++++ KVH++T A+NIVK ++RCGL+V L Sbjct 127 QILHILTQEFIIDGQEDVREPLGMSGMKLEVKVHIVTGAVSAAQNIVKCIKRCGLEVSDL 186 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I LASS +VLTEDE+ELGVC+VDIGGGT DIAV+ GA+RHT V+P AG+ +T+D+A Sbjct 187 ILQPLASSLAVLTEDEKELGVCLVDIGGGTTDIAVFKQGAIRHTAVVPIAGDQITNDVAV 246 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 AF TP AE IK++HGCAL + E VEVP V GR PR L QTLAEVIEPR EL Sbjct 247 AFRTPTQSAEEIKIKHGCALRQLADAREVVEVPGVDGRDPRQLSVQTLAEVIEPRVVELY 306 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 V +LR+ G++ +A+GIV+TGG++ ++G+ + +FH VR+G P N+ Sbjct 307 EFV-------LGELRRSGMEEMIASGIVITGGSSLMKGMVELGEEIFHMPVRLGMPRNVG 359 Query 366 GLTDYAQEPYYSTAVGLLHYGKES---HLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 GL++ P Y+T VGL+ G++ L G+ E S + R+ SW + F Sbjct 360 GLSEVVGNPRYATGVGLVLMGQQQVERQLQGQMESN-----SFSQVLSRMKSWFQGNF 412 >gi|74020125|ref|ZP_00690731.1| Cell division protein FtsA [Burkholderia ambifaria AMMD] gi|72607163|gb|EAO43129.1| Cell division protein FtsA [Burkholderia ambifaria AMMD] Length=461 Score = 516 bits (1331), Expect = 7e-145, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 273/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 57 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 116 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 117 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 176 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 177 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 236 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 237 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 296 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 297 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 356 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 357 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 409 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + G R+ W F Sbjct 410 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GNAGQIFSRMKEWFLSNF 461 >gi|53755279|emb|CAH16773.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Lens] gi|53752384|emb|CAH13816.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Paris] gi|54298599|ref|YP_124968.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Paris] gi|54295447|ref|YP_127862.1| Gene info ATP-binding cell division protein FtsA [Legionella pneumophila str. Lens] Length=412 Score = 516 bits (1330), Expect = 9e-145, Method: Composition-based stats. Identities = 188/420 (44%), Positives = 273/420 (65%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K ++ ++ GL+IGT+K+ AL+GEV DG + IIG+G PSRG+ +G V D+E+ V Sbjct 1 MAKKIEKNIITGLDIGTSKIIALIGEVTSDGTIEIIGIGRHPSRGLKRGVVVDIETTVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+ +AELMA C++ +VY ++G HI N G+V I ++EV+Q DVE V+ AK+V Sbjct 61 IQRAVQEAELMAGCEVRTVYAGIAGSHIRSLNSHGIVAIRDQEVSQADVERVIDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID+Q I+ P+G++GVR++++VH++T A+NIVK V RCGL Sbjct 121 IPADQKILHILPQEFIIDHQGSIREPIGMAGVRLESRVHIVTGSVSAAQNIVKCVRRCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V +I LASS++VLTEDE+ELGVC++DIGGGT DIA++ GA++HT VIP AG+ VT Sbjct 181 DVIDIILEQLASSHAVLTEDEKELGVCLIDIGGGTTDIAIFCEGAIQHTSVIPIAGDQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEAIKV H CAL + ++ +EV SV RP R + + LA+V+ R Sbjct 241 NDIAMALRTPTKAAEAIKVNHACALPELANPNQMLEVTSVNDRPGRKISAKALADVVSAR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +LV E LR+ G + LAAGIVLTGGA+ + G A+ F VR G Sbjct 301 YEELFSLVRNE-------LRRSGFEDRLAAGIVLTGGASNVRGAIELAELCFEMPVRKGC 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++GLT+ + P ++T VGLL +G + V + + S R+ W + F Sbjct 354 AHYVSGLTEATENPSFATGVGLLLHGFQQQYESGYNV-PAMNDNGKSIWSRMKEWFQGNF 412 >gi|52629927|gb|AAU28668.1| Gene info cell division protein FtsA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52842816|ref|YP_096615.1| Gene info cell division protein FtsA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length=420 Score = 516 bits (1330), Expect = 9e-145, Method: Composition-based stats. Identities = 188/420 (44%), Positives = 273/420 (65%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K ++ ++ GL+IGT+K+ AL+GEV DG + IIG+G PSRG+ +G V D+E+ V Sbjct 9 MAKKIEKNIITGLDIGTSKIIALIGEVTSDGTIEIIGIGRHPSRGLKRGVVVDIETTVNS 68 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+ +AELMA C++ +VY ++G HI N G+V I ++EV+Q DVE V+ AK+V Sbjct 69 IQRAVQEAELMAGCEVRTVYAGIAGSHIRSLNSHGIVAIRDQEVSQADVERVIDAAKAVA 128 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++LH++PQE+ ID+Q I+ P+G++GVR++++VH++T A+NIVK V RCGL Sbjct 129 IPADQKILHILPQEFIIDHQGSIREPIGMAGVRLESRVHIVTGSVSAAQNIVKCVRRCGL 188 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V +I LASS++VLTEDE+ELGVC++DIGGGT DIA++ GA++HT VIP AG+ VT Sbjct 189 DVIDIILEQLASSHAVLTEDEKELGVCLIDIGGGTTDIAIFCEGAIQHTSVIPIAGDQVT 248 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA A TP AEAIKV H CAL + ++ +EV SV RP R + + LA+V+ R Sbjct 249 NDIAMALRTPTKAAEAIKVNHACALPELANPNQMLEVTSVNDRPGRKISAKALADVVSAR 308 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL +LV E LR+ G + LAAGIVLTGGA+ + G A+ F VR G Sbjct 309 YEELFSLVRNE-------LRRSGFEDRLAAGIVLTGGASNVRGAIELAELCFEMPVRKGC 361 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++GLT+ + P ++T VGLL +G + V + + S R+ W + F Sbjct 362 AHYVSGLTEATENPSFATGVGLLLHGFQQQYESGYNV-PAMNDNGKSIWSRMKEWFQGNF 420 >gi|82703604|ref|YP_413170.1| Gene info cell division protein FtsA [Nitrosospira multiformis ATCC 25196] gi|82411669|gb|ABB75778.1| Gene info cell division protein FtsA [Nitrosospira multiformis ATCC 25196] Length=412 Score = 513 bits (1323), Expect = 5e-144, Method: Composition-based stats. Identities = 194/421 (46%), Positives = 279/421 (66%), Gaps = 10/421 (2%) Query 1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 M + ++ + LVVG++IGT+K+ +V E+ P+G +IG+GS PSRG+ KG V ++++ V Sbjct 1 MNRGSEGKNLVVGIDIGTSKIVTVVAEMKPEGGYTVIGMGSHPSRGLKKGVVVNIDATVN 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 +QRA+++AELMADC+I VY ++G HI N GMVPI +EV+++DVE V+ TAK+V Sbjct 61 AIQRALEEAELMADCKIREVYTGIAGSHIKSFNSHGMVPIKNKEVSRQDVERVMETAKAV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + ++ +VLHV+ QE+ ID QE + P+G+SGVR++ KVH++T +NI+K V RCG Sbjct 121 NILNDQQVLHVLNQEFIIDEQEDVLEPIGMSGVRLEVKVHIVTGSVSAVQNILKCVRRCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+V L+ LAS+ +VL+EDE++LGVC++DIGGGT DIA++T GA+RHT VIP AG+ + Sbjct 181 LEVRDLVLQPLASAMAVLSEDEKDLGVCLLDIGGGTTDIAIFTRGAIRHTAVIPIAGDQI 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA A T PSDAE IK R+GCAL S+ E VEV VG R R L RQTLAEVIEP Sbjct 241 TNDIALALRTSPSDAEDIKCRYGCALRSMADPHEMVEVAGVGNRSVRHLSRQTLAEVIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R EL +LV Q +LR+ G + L++GIV+TGG++ +EG+ + +FH VR+G Sbjct 301 RVEELYSLV-------QAELRRSGFEELLSSGIVITGGSSSLEGMVELGEEIFHMPVRLG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P L + P ST +GL+ G + E + S + R+ SW + Sbjct 354 LPKYHGSLEEVVVTPRCSTGIGLILAGVDQLQQHE--QTRLEGNSFSRILDRMKSWFQVN 411 Query 420 F 420 F Sbjct 412 F 412 >gi|48781047|ref|ZP_00277701.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia fungorum LB400] Length=410 Score = 513 bits (1323), Expect = 6e-144, Method: Composition-based stats. Identities = 192/414 (46%), Positives = 275/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE +EVP +G R PR+L RQ LA V+EPR EL + Sbjct 246 LRTPTPDAEDIKVDYGIAKQALADPDEMIEVPGLGERGPRTLSRQALAAVVEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGA+ + G+ + +F VRIG P G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGASMMLGMVELGEDIFLKPVRIGVPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G+ + G + S+G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGRSQRMRGRKVAVQS--GSMGQVFTRMKDWFLGNF 410 >gi|17429863|emb|CAD16547.1| Gene info PROBABLE CELL DIVISION PROTEIN FTSA [Ralstonia solanacearum] gi|17547559|ref|NP_520961.1| Gene info PROBABLE CELL DIVISION PROTEIN FTSA [Ralstonia solanacearum GMI1000] Length=410 Score = 513 bits (1322), Expect = 8e-144, Method: Composition-based stats. Identities = 184/414 (44%), Positives = 268/414 (64%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KV A+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVVAVVAELRPDGAYEVIGMGQTESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS V+ ++G HI N GMV I ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKISEVFTGIAGSHIRSFNSSGMVAIKDKEVTPADVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIG GT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGSGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G A + DE ++VP VG R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKIQYGIAKQVLADPDEMIDVPGVGDRGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ +R+ G + L++G+VLTGG A + G+ + +F VR+G P Sbjct 306 LVHQ-------VVRESGYEELLSSGVVLTGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P Y+T +GLL G+ + G + S R+ W F Sbjct 359 LHEVVKSPRYATVMGLLQEGRVQRMRGRKVAVQS--GSAKQVWTRMKEWFIGNF 410 >gi|52429463|gb|AAU50056.1| Gene info cell division protein FtsA [Burkholderia mallei ATCC 23344] gi|76581316|gb|ABA50791.1| Gene info cell division protein FtsA [Burkholderia pseudomallei 1710b] gi|76811863|ref|YP_334910.1| Gene info cell division protein FtsA [Burkholderia pseudomallei 1710b] gi|83720984|ref|YP_441670.1| Gene info cell division protein FtsA [Burkholderia thailandensis E264] gi|53726040|ref|YP_104090.1| Gene info cell division protein FtsA [Burkholderia mallei ATCC 23344] gi|83654809|gb|ABC38872.1| Gene info cell division protein FtsA [Burkholderia thailandensis E264] gi|87314929|ref|ZP_01095965.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 2002721280] gi|67761837|ref|ZP_00500543.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei S13] gi|67755851|ref|ZP_00494741.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei Pasteur] gi|67737674|ref|ZP_00488423.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 668] gi|85065688|ref|ZP_01026541.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 10229] gi|67684771|ref|ZP_00478698.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1710a] gi|67673292|ref|ZP_00470059.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1655] gi|84523721|ref|ZP_01010857.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei SAVP1] gi|67649132|ref|ZP_00447358.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei NCTC 10247] gi|67643625|ref|ZP_00442370.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei GB8 horse 4] gi|67637729|ref|ZP_00436667.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei 10399] gi|83680174|ref|ZP_00941882.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 406e] gi|83625696|ref|ZP_00935926.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei JHU] gi|83621163|ref|ZP_00931575.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia mallei FMH] gi|82535386|ref|ZP_00894404.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1106b] gi|82531156|ref|ZP_00890378.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia pseudomallei 1106a] Length=410 Score = 512 bits (1321), Expect = 9e-144, Method: Composition-based stats. Identities = 195/414 (47%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAVVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + S G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GSAGQIFSRMKEWFLSNF 410 >gi|30138616|emb|CAD84907.1| Gene info Cell division protein FtsA [Nitrosomonas europaea ATCC 19718] gi|30248999|ref|NP_841069.1| Gene info Cell division protein FtsA [Nitrosomonas europaea ATCC 19718] Length=412 Score = 511 bits (1317), Expect = 3e-143, Method: Composition-based stats. Identities = 195/421 (46%), Positives = 279/421 (66%), Gaps = 10/421 (2%) Query 1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 M K + + L+VGL+IGT+K+ A+V E+ P+G IIG+GS SRG+ KG V ++E+ V Sbjct 1 MSKVKEGKDLIVGLDIGTSKIVAIVAEMKPEGGFEIIGLGSHLSRGLKKGVVVNIEATVN 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 +QRA+++ ELMA C+IS VY ++G HI N GMV I ++EVTQ DVE V+ TAK+V Sbjct 61 AIQRALEEVELMAGCRISEVYAGIAGNHIRGFNSHGMVAIKDKEVTQADVEKVMETAKAV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + ++LH++ QE+ ID QE ++ PVG+SG+R++ KVH++T A+NI K + RCG Sbjct 121 NIPADQQILHILNQEFIIDGQEDVREPVGMSGIRLEVKVHIVTGAVSAAQNIAKCIHRCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L V L+ LAS+ +VL+EDE++LGVC+VDIGGGT DIAV+T GA+RHT VIP AG+ + Sbjct 181 LDVRDLVLQPLASAKAVLSEDEKDLGVCLVDIGGGTTDIAVFTDGAIRHTAVIPVAGDQI 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA A TP DAE IK R+G AL ++ E VEVP VG R R L RQTLAEVIEP Sbjct 241 TNDIAMALRTPTKDAEDIKCRYGIALRTLADIREMVEVPDVGNRGARPLSRQTLAEVIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R EL L+ Q +LR+ G + L++GIV+TGG++ + G+ + +FH VR+G Sbjct 301 RVEELYLLI-------QAELRRSGFEQLLSSGIVITGGSSSMLGMVELGEEIFHMPVRLG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P+ L + + P YSTA+GL+ G E L+ K ++S + ++ W ++ Sbjct 354 LPVYNGSLEEVVRTPRYSTAIGLVMVGMEDRLHHH--QAKLKSSSTRQILAKMKGWFQEN 411 Query 420 F 420 F Sbjct 412 F 412 >gi|52211045|emb|CAH37033.1| Gene info cell division protein FtsA [Burkholderia pseudomallei K96243] gi|53720631|ref|YP_109617.1| Gene info cell division protein FtsA [Burkholderia pseudomallei K96243] Length=410 Score = 510 bits (1316), Expect = 3e-143, Method: Composition-based stats. Identities = 194/414 (46%), Positives = 273/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ + +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAVVAELKGESHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I E+EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKEKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+VLTGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVLTGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + S G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GSAGQIFSRMKEWFLSNF 410 >gi|71836424|ref|ZP_00676193.1| Cell division protein FtsA [Pelobacter propionicus DSM 2379] gi|71743254|gb|EAO38403.1| Cell division protein FtsA [Pelobacter propionicus DSM 2379] Length=412 Score = 510 bits (1316), Expect = 3e-143, Method: Composition-based stats. Identities = 186/420 (44%), Positives = 275/420 (65%), Gaps = 8/420 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M L+VGL+IGT K+ A+VG V DG ++I+G+G+ PS G+ +G V ++ES V Sbjct 1 MSATRRDNLIVGLDIGTTKICAIVGNVTEDG-IDIVGIGTSPSSGLRRGVVINIESTVGA 59 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +++AI++AELMA C+I SVY ++G HI N G++ I EV QED+ V+ AK++ Sbjct 60 IRKAINEAELMAGCEIKSVYAGIAGGHIRGTNSQGVIAIKNREVNQEDIRRVIDAAKAIA 119 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NIVK+ R GL Sbjct 120 IPMDREVIHILPQEFIIDEQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIVKSCNRTGL 179 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 V ++ LASS +VL+ DE+ELGVC+VDIGGGT DIA++ GA+++T V+ GN +T Sbjct 180 DVADIVLEQLASSEAVLSADEKELGVCLVDIGGGTTDIAIFADGAIKYTSVLSLGGNHLT 239 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA TP ++AE IK ++GC L S+VGKD+ +EVPSVGGR PR L R L E++ PR Sbjct 240 NDIAVGLRTPMAEAEKIKQKYGCCLSSLVGKDDKIEVPSVGGRKPRELSRNVLCEILGPR 299 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+ +LVN EI+ + G++ +A+G+V+TGG + +EG+ A+++F+ VR G Sbjct 300 VEEIFSLVNREII-------KSGLEDSIASGVVITGGTSILEGMPELAEQIFNLPVRRGV 352 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P I GL D P Y+T VGL+ YG + E K GS + R+ SW + F Sbjct 353 PQRIGGLIDVVNSPVYATGVGLVVYGSRNSGAREFPSVKPENKLFGSVLGRMKSWFGEFF 412 >gi|27360153|gb|AAO09091.1| Gene info Cell division protein FtsA [Vibrio vulnificus CMCP6] gi|27364036|ref|NP_759564.1| Gene info cell division protein [Vibrio vulnificus CMCP6] Length=433 Score = 510 bits (1316), Expect = 4e-143, Method: Composition-based stats. Identities = 278/389 (71%), Positives = 340/389 (87%), Gaps = 0/389 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K D ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK Sbjct 1 MTKTADDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAE+MA+CQIS+V+++LSGKHI+ + E GM IS+EEV+QED++ +HTAKS++ Sbjct 61 VQRAIDQAEMMAECQISNVFISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + DE R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+ VHLI+CHNDMA+NI+KAVERCGL Sbjct 121 IGDEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV+Q++F+GLA+S +V+TEDERELGVCVVDIG GTMD+A++TGGALRHT+V YAGN VT Sbjct 181 KVEQIVFSGLAASNAVITEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA+AFGTP SDAE IKV++GCAL +V KD++V VPSVGGRP RSLQRQTL+EVIEPR Sbjct 241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y+EL+ LVN+ I +Q KLR+ G+KHHLAAG+VLTGGAAQIEGL CA+RVF QVR+G Sbjct 301 YSELMGLVNQTIESVQMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKES 389 PL ++GLTDY +EPY+STAVGLLHY ++ Sbjct 361 PLEVSGLTDYVKEPYHSTAVGLLHYARDM 389 >gi|82495625|ref|ZP_00881199.1| Cell division protein FtsA [Shewanella sp. MR-4] gi|82406217|gb|EAP46883.1| Cell division protein FtsA [Shewanella sp. MR-4] Length=393 Score = 510 bits (1315), Expect = 5e-143, Method: Composition-based stats. Identities = 248/400 (62%), Positives = 318/400 (79%), Gaps = 7/400 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKR 400 PL + GL +Y + YST VGLLHYG L + E +R Sbjct 354 PLPVKGLYEYVDQSIYSTGVGLLHYGARRVLERQFERPER 393 >gi|83748770|ref|ZP_00945785.1| FtsA [Ralstonia solanacearum UW551] gi|83724591|gb|EAP71754.1| FtsA [Ralstonia solanacearum UW551] Length=410 Score = 510 bits (1315), Expect = 5e-143, Method: Composition-based stats. Identities = 184/414 (44%), Positives = 267/414 (64%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KV A+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVVAVVAELRPDGAYEVIGMGQTESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS V+ ++G HI N GMV I ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKISEVFTGIAGSHIRSFNSSGMVAIKDKEVTPADVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLTEDE+ELGV +VDIG GT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLSVLTEDEKELGVVLVDIGSGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G + DE ++VP VG R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKIQYGIGKQVLADPDEMIDVPGVGDRGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ +R+ G + L++G+VLTGG A + G+ + +F VR+G P Sbjct 306 LVHQ-------VVRESGYEELLSSGVVLTGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P Y+T +GLL G+ + G + S R+ W F Sbjct 359 LHEVVKSPRYATVMGLLQEGRVQRMRGRKVAVQS--GSAKQVWTRMKEWFIGNF 410 >gi|88858806|ref|ZP_01133447.1| Cell division protein [Pseudoalteromonas tunicata D2] gi|88819032|gb|EAR28846.1| Cell division protein [Pseudoalteromonas tunicata D2] Length=410 Score = 509 bits (1314), Expect = 6e-143, Method: Composition-based stats. Identities = 233/420 (55%), Positives = 304/420 (72%), Gaps = 10/420 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K+ +R LV+GL++GT+KV A VGE+ D ++I+GVG+ S GMDKGGVNDL V + Sbjct 1 MTKSAERNLVIGLDVGTSKVVATVGEITADNKISIVGVGTQVSHGMDKGGVNDLNLVSES 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID AE+MADC+ISSVYL +SGKHI CQNE G+V I+ EV +D+ENV+H AKSV Sbjct 61 IQRAIDAAEIMADCRISSVYLGISGKHIQCQNENGVVAINNAEVGPDDIENVIHIAKSVP 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E ++LH +PQEY+ID QEGIKNP+G+SGVRM+A+ H+ITC NDMAKNI K VERCGL Sbjct 121 ISAERKMLHALPQEYSIDMQEGIKNPLGMSGVRMEARAHIITCSNDMAKNIEKCVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VDQLIF+ LAS YSVLTEDE+ELGV V+DIGGGTMDI +YT G+LRH+ VI AGN VT Sbjct 181 QVDQLIFSALASGYSVLTEDEKELGVAVIDIGGGTMDITIYTNGSLRHSAVITVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DIA F TP S AEAIKV++ CA ++++EVPSVGGRP R + R TLAEV+EPR Sbjct 241 GDIAKIFRTPISHAEAIKVQYACASSQRASTEDTIEVPSVGGRPARIMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 + EL L EEI R+ G++ +AAG+VLTGG A++ A+ +F R+G+ Sbjct 301 FRELFELAMEEI-------RRSGLEEQIAAGVVLTGGTAKMAYALEIAEEIFQMPARVGS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ + GL+DY +P ++TAVGLL YG+ + A K ++ +W R+ W + EF Sbjct 354 PIGMVGLSDYVNDPSFATAVGLLQYGRTMQV---ANARKSTESTSANWWNRVTKWFQGEF 410 >gi|77965870|gb|ABB07250.1| Gene info Cell division protein FtsA [Burkholderia sp. 383] gi|78065125|ref|YP_367894.1| Gene info Cell division protein FtsA [Burkholderia sp. 383] gi|67662064|ref|ZP_00459355.1| Cell division protein FtsA [Burkholderia cenocepacia HI2424] gi|67660712|ref|ZP_00458052.1| Cell division protein FtsA [Burkholderia cenocepacia AU 1054] gi|84356657|ref|ZP_00981496.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia cenocepacia PC184] gi|67104649|gb|EAM21768.1| Cell division protein FtsA [Burkholderia cenocepacia HI2424] gi|67091702|gb|EAM09271.1| Cell division protein FtsA [Burkholderia cenocepacia AU 1054] Length=410 Score = 509 bits (1314), Expect = 7e-143, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 274/414 (66%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + P YSTA+GLL G + G + + G R+ W F Sbjct 359 LSDVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GNAGQVFSRMKEWFLSNF 410 >gi|78192892|gb|ABB30659.1| Gene info Cell division protein FtsA [Geobacter metallireducens GS-15] gi|78221637|ref|YP_383384.1| Gene info Cell division protein FtsA [Geobacter metallireducens GS-15] Length=411 Score = 509 bits (1313), Expect = 8e-143, Method: Composition-based stats. Identities = 190/419 (45%), Positives = 276/419 (65%), Gaps = 8/419 (1%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + A L+VGL+IGT K+ A+VG V DG ++I+G+GS PSRGM KG V ++ES V+ + Sbjct 1 MSARRDNLIVGLDIGTTKICAIVGNVTEDG-IDIVGIGSSPSRGMRKGVVINIESTVESI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+ +AELMA C+I SVY ++G HI N G++ I EVT EDV+ V+ AK++ + Sbjct 60 KKAVSEAELMAGCEIRSVYAGIAGGHIKGFNSQGVIAIKNREVTSEDVKRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NIVKA R GL Sbjct 120 PMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIVKACNRAGLD 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE+ELGV +VDIGGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEQLASSEAVLSADEKELGVALVDIGGGTTDIAIFVDGAIKHTSVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GC + S+VGK+E++EVPSVGGR PR L RQ LAE++EPR Sbjct 240 DIAVGLRTPMAEAEKIKQKYGCCMASLVGKEETIEVPSVGGRKPRVLSRQLLAEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G + +A+G+V+TGG +EG+ A++VF+ VR G P Sbjct 300 EEIFTLVNREIM-------KSGFEDLIASGVVITGGTTILEGMPELAEQVFNLPVRRGMP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GL D P Y+T VGL+ YG ++ E + +R+ W + F Sbjct 353 QQIGGLVDVVNSPVYATGVGLVVYGSKNVGIREFPTAQTDENLFRRVSRRMKEWFGEFF 411 >gi|72120072|gb|AAZ62335.1| Gene info Cell division protein FtsA [Ralstonia eutropha JMP134] gi|73542659|ref|YP_297179.1| Gene info Cell division protein FtsA [Ralstonia eutropha JMP134] Length=410 Score = 509 bits (1313), Expect = 9e-143, Method: Composition-based stats. Identities = 187/414 (45%), Positives = 272/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KVAA+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +Q+A++ Sbjct 6 KDLLVGLDIGTSKVAAVVAELRPDGSYEVIGMGQSESKGLKKGVVVNIEATVQSIQKALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ V+ ++G HI N GMV I ++EVTQ DV V+ TAK+V + + + Sbjct 66 EAELMADCKIAEVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV++G A +I ++ +EVP VG R R+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVQYGIAKQAIADPEDMIEVPGVGDRGTRTLSRQALAAVIEPRIEELYS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ +R+ G + L++G+V+TGG A + G+ + +F VR+G P Sbjct 306 LVHQ-------VVRESGYEELLSSGVVITGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P YST +GLL G+ + G + SV R+ W F Sbjct 359 LHEVVKSPRYSTVMGLLLEGRVQRMRGRKVAVQS--GSVKQVWGRMKEWFVGNF 410 >gi|84360668|ref|ZP_00985364.1| COG0849: Actin-like ATPase involved in cell division [Burkholderia dolosa AUO158] Length=410 Score = 509 bits (1313), Expect = 9e-143, Method: Composition-based stats. Identities = 192/414 (46%), Positives = 273/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVALDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGAA + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGAAMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GNAGQIFSRMKEWFLSNF 410 >gi|78034820|emb|CAJ22465.1| Gene info cell division protein FtsA [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|21106905|gb|AAM35671.1| Gene info cell division protein [Xanthomonas axonopodis pv. citri str. 306] gi|21111742|gb|AAM40044.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66575139|gb|AAY50549.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. 8004] gi|78046390|ref|YP_362565.1| Gene info cell division protein FtsA [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|66769807|ref|YP_244569.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. 8004] gi|21241553|ref|NP_641135.1| Gene info cell division protein [Xanthomonas axonopodis pv. citri str. 306] gi|21230203|ref|NP_636120.1| Gene info cell division protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length=411 Score = 509 bits (1312), Expect = 1e-142, Method: Composition-based stats. Identities = 196/421 (46%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + D+ L+VGL+IGT+KV ALVGE P + +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGDKSLIVGLDIGTSKVVALVGEYSPGNPIEVIGIGSHESRGLKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+VPI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSPGIVPIRDGEVTWSDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDY-QEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI K V++CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANITKCVQKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + LASS +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLASSVAVLTADERELGVVLVDIGAGTTDLAVYVQGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQLATAEESIQVPSVGDRPPRRMPRHALAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEEMVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T GS K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQIEHPRRPSI---PTGRAGSLFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|67548901|ref|ZP_00426780.1| Cell division protein FtsA [Burkholderia vietnamiensis G4] gi|67529786|gb|EAM26642.1| Cell division protein FtsA [Burkholderia vietnamiensis G4] Length=410 Score = 508 bits (1311), Expect = 1e-142, Method: Composition-based stats. Identities = 191/414 (46%), Positives = 273/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+ +G +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I++V+ ++G HI N GMV I ++EVTQ DV V+ TAK++ + + + Sbjct 66 EAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAINIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V+ LI Sbjct 126 VLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVNDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE++LGV +VDIGGGT DIA++ GA+RHT VIP AG+ +TSDIA A Sbjct 186 LQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAEGAIRHTAVIPIAGDQITSDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +G A ++ DE VEVP +G R PR+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGERGPRTLSRQALAAVIEPRVEELFS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV Q+ +R+ G + L++G+V+TGGA+ + G+ + +F VRIGAP G Sbjct 306 LV-------QQVVRESGYEELLSSGVVITGGASMMPGMVELGEDIFLKPVRIGAPEYAGG 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D + P YSTA+GLL G + G + + G R+ W F Sbjct 359 LADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQS--GNAGQIFSRMKEWFLSNF 410 >gi|68559742|ref|ZP_00599073.1| Cell division protein FtsA [Ralstonia metallidurans CH34] gi|68525904|gb|EAN48879.1| Cell division protein FtsA [Ralstonia metallidurans CH34] Length=410 Score = 508 bits (1311), Expect = 1e-142, Method: Composition-based stats. Identities = 187/414 (45%), Positives = 271/414 (65%), Gaps = 9/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+VGL+IGT+KVAA+V E+ PDG +IG+G S+G+ KG V ++E+ V+ +QRA++ Sbjct 6 KDLLVGLDIGTSKVAAVVAELRPDGSYEVIGMGQSESKGLKKGVVVNIEATVQSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ V+ ++G HI N GMV I ++EVTQ DV V+ TAK+V + + + Sbjct 66 EAELMADCKIAEVFTGIAGSHIRSFNSSGMVAIKDKEVTQTDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +LH++ QE+ ID QE ++ P+G+SG+R++ KVH++T A+NIVK V RCGL+V LI Sbjct 126 ILHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGAVSAAQNIVKCVRRCGLEVHDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLTEDE+ELGV +VDIGGGT DIA+++ GA+RHT VIP AG+ +T+DIA A Sbjct 186 LQPLASSLAVLTEDEKELGVVLVDIGGGTTDIAIFSEGAIRHTAVIPIAGDQITNDIAMA 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+++G A +I ++ +EVP VG R R+L RQ LA VIEPR EL + Sbjct 246 LRTPTPDAEDIKMQYGIAKQAIADPEDMIEVPGVGDRGTRTLSRQALAAVIEPRIEELYS 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ +R+ G + L++G+V+TGG A + G+ + +F VR+G P Sbjct 306 LVHQ-------VVRESGYEELLSSGVVITGGTAMMPGMVELGEDIFLKPVRVGVPEYRGN 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L + + P YST +GLL G + G + SV R+ W F Sbjct 359 LHEVVKSPRYSTVMGLLQEGCVQRMRGRKVAVQS--GSVKQVWGRMKEWFVGNF 410 >gi|84369197|dbj|BAE70355.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|84625257|ref|YP_452629.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|58583446|ref|YP_202462.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] gi|58428040|gb|AAW77077.1| Gene info cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] Length=411 Score = 508 bits (1310), Expect = 2e-142, Method: Composition-based stats. Identities = 196/421 (46%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + D+ L+VGL+IGT+KV ALVGE P + +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGDKSLIVGLDIGTSKVVALVGEYSPGNPIEVIGIGSHESRGLKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+VPI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSPGIVPIRDGEVTWSDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDY-QEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ + HL+ C A NI K V++CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVQAHLVVCAQSAAANITKCVQKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L VD L+ + LASS +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LHVDDLVLSSLASSVAVLTADERELGVVLVDIGAGTTDLAVYVQGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQLATAEESIQVPSVGDRPPRRMPRHALAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEEMVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T GS K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQIEHPRRPSI---PTGRAGSLFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|89095255|ref|ZP_01168176.1| Cell division protein FtsA [Oceanospirillum sp. MED92] gi|89080462|gb|EAR59713.1| Cell division protein FtsA [Oceanospirillum sp. MED92] Length=413 Score = 508 bits (1309), Expect = 2e-142, Method: Composition-based stats. Identities = 204/420 (48%), Positives = 284/420 (67%), Gaps = 11/420 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 + ++V L+IGT+KV LVGEV DG ++IIG+GS SRG+ KG V ++ES V +QRA Sbjct 1 MENNMIVALDIGTSKVLCLVGEVGIDGTIDIIGIGSHASRGLKKGVVVNIESTVSSIQRA 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 +++AELMA C+I SV + ++G HI+ N G+V + + EVT+ D+E V+ AK+V + + Sbjct 61 VEEAELMAGCKIHSVTVGIAGSHINSMNSHGIVAVRDREVTEYDLERVIDAAKAVPIPAD 120 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++LHV+PQEY ID EGIK P+G+SGVR++AKVHL+T + A+NI K V RCGL+VD Sbjct 121 QKILHVLPQEYEIDGSEGIKEPLGMSGVRLEAKVHLVTGSVNAAQNIEKCVRRCGLEVDN 180 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 L+ LASSYSVLTEDE+ELGVC+VDIGGGT DI+++TGG++RHT VIP AG+ VT+DIA Sbjct 181 LVLEQLASSYSVLTEDEKELGVCMVDIGGGTSDISIFTGGSIRHTAVIPIAGDQVTNDIA 240 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 A TP AE IKV++ CAL + E+V+VP VG RP R L RQ+LAEV+EPRY EL Sbjct 241 MALRTPTQHAEDIKVKYACALAQLASAGETVKVPGVGDRPARDLSRQSLAEVVEPRYEEL 300 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L+ Q +LR+ G + +AAG+VLTGG +++EG A+ +FH VR+ P Sbjct 301 FTLI-------QAELRRSGFEDLVAAGVVLTGGTSKMEGAVELAEEIFHMPVRLATPHGA 353 Query 365 TGLTDYAQEPYYSTAVGLLHYGKESHL----NGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 G+ D P Y+T +GLL Y + H+ V + V S ++R+ +W + F Sbjct 354 RGMEDILDSPIYATGIGLLQYARHDHVVAAEETTVGVNEVVNRPQVSVLERMKAWFQSNF 413 >gi|68543485|ref|ZP_00583188.1| Cell division protein FtsA [Shewanella baltica OS155] gi|68518789|gb|EAN42347.1| Cell division protein FtsA [Shewanella baltica OS155] Length=407 Score = 506 bits (1305), Expect = 8e-142, Method: Composition-based stats. Identities = 249/400 (62%), Positives = 319/400 (79%), Gaps = 7/400 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK DR L+VGL+IGT+KVA ++GEVLPDG ++I+G+G+ PSRGMDKGGVNDL+S+V+ Sbjct 1 MIKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRGMDKGGVNDLDSIVRS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+DQAELMADCQ+SSVYL++SGKHI+CQNE GMV I++EEVTQEDV+NV+HTA+SV+ Sbjct 61 VQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEVTQEDVDNVIHTARSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQEYAID Q+GI++P+G+SG+RM+AKVH++TC NDMAKNI K+VERCGL Sbjct 121 IPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTCANDMAKNITKSVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD L+F+G+AS+ +VLT DE++LGVC+VDIGGGT DIAVYT GALRH V+P AGN VT Sbjct 181 KVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYTNGALRHCAVVPVAGNQVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DIA F TP S AE IKV+ CA S+V +++S+EVPSVGGRP RS+ R TLAEV+EPR Sbjct 241 NDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVGGRPSRSMSRHTLAEVVEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV +E L+ G++ +AAGIVLTGG A I+G+ A+ F VR+ + Sbjct 301 YQELFELVLKE-------LKDSGLEDQIAAGIVLTGGTASIQGVVDIAEATFGMPVRVAS 353 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKR 400 PL I GL +Y + YST VGLLHYG + + E +R Sbjct 354 PLPIKGLYEYVDQSIYSTGVGLLHYGARRVIERQFERPER 393 >gi|56178561|gb|AAV81283.1| Gene info Cell division ATPase, FtsA [Idiomarina loihiensis L2TR] gi|56459551|ref|YP_154832.1| Gene info Cell division ATPase, FtsA [Idiomarina loihiensis L2TR] Length=402 Score = 505 bits (1302), Expect = 2e-141, Method: Composition-based stats. Identities = 242/412 (58%), Positives = 316/412 (76%), Gaps = 10/412 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 +VVGL+IGT+KV AL+GE+LPD ++++GVG+ SRGMDKGGVNDL VV+ VQRA+D+A Sbjct 1 MVVGLDIGTSKVTALIGELLPDNEISVVGVGTATSRGMDKGGVNDLNLVVQSVQRAVDEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMADC+++SVYL +SG+HISCQNE GMVPI+E EVTQ+DV++V+H A+SV + E R+L Sbjct 61 ELMADCRVASVYLNISGRHISCQNESGMVPINEAEVTQDDVDSVIHAAQSVPIAKERRIL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQEY ID QE I++P+G+SGVRM++KVH+ITC NDMAKNI+KAVERCGL VD+LIF+ Sbjct 121 HVLPQEYVIDSQESIRSPIGMSGVRMESKVHIITCANDMAKNIIKAVERCGLSVDKLIFS 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS SVLT+DE++LGV +VD+GGGT+DI +Y GG LRHT VIP AGN VTSDIA F Sbjct 181 ALASSISVLTDDEKDLGVALVDLGGGTIDICIYAGGVLRHTAVIPAAGNQVTSDIAKIFR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP + AE IK +H CAL +V ++++EVPSVGGRP R + R TLAEV+EPRY EL LV Sbjct 241 TPTNHAEEIKTKHACALRQMVSMEDTIEVPSVGGRPSRVMSRHTLAEVVEPRYQELFELV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +EI +Q G+ +AAG+V+TGG+A++EG A+ +F VRIG PL + GL Sbjct 301 RDEI-------QQSGLDEQIAAGVVITGGSAKMEGCVDFAEEIFQMPVRIGVPLGMKGLR 353 Query 369 DYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 DY ++P Y+TAVGLL YG+E + E K V +++ SW + EF Sbjct 354 DYVEDPVYATAVGLLRYGQEDAAVSQKESSK---TDVIGLWQKVQSWFKGEF 402 >gi|33568800|emb|CAE34558.1| Gene info cell division protein FtsA [Bordetella bronchiseptica RB50] gi|33566816|emb|CAE39031.1| Gene info cell division protein FtsA [Bordetella parapertussis] gi|33564024|emb|CAE43290.1| Gene info cell division protein FtsA [Bordetella pertussis Tohama I] gi|33593950|ref|NP_881594.1| Gene info cell division protein FtsA [Bordetella pertussis Tohama I] gi|33598258|ref|NP_885901.1| Gene info cell division protein FtsA [Bordetella parapertussis 12822] gi|33603169|ref|NP_890729.1| Gene info cell division protein FtsA [Bordetella bronchiseptica RB50] Length=408 Score = 504 bits (1301), Expect = 2e-141, Method: Composition-based stats. Identities = 187/410 (45%), Positives = 266/410 (64%), Gaps = 9/410 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + L+V L+IGT+KV A+V E+LP+G ++G+G SRGM KG V ++E+ V +QRA++ Sbjct 6 KDLIVALDIGTSKVVAVVAEILPEGRFEVLGLGQHESRGMRKGVVVNIETTVNSIQRALE 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I VY ++G HI N GMV + ++EVT DV V+ TAK+V + + + Sbjct 66 EAELMADCKIRDVYAGIAGSHIRSFNSSGMVAVKDKEVTATDVARVIETAKAVNIPTDQQ 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 VLHV+ QE+ +D QE I+ P+G+SG+R++ +VH++T A+NIVK V RCGL+V LI Sbjct 126 VLHVLTQEFIVDGQEDIREPIGMSGLRLEVRVHIVTGAVSAAQNIVKCVRRCGLEVQDLI 185 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS + LT DE+ELGV +VDIGGGT D+A++TGGA+RHT VIP AG+ +T+DIA Sbjct 186 LQPLASSLACLTADEKELGVVLVDIGGGTTDVAIFTGGAIRHTAVIPIAGDQITNDIAAM 245 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IK+R+G A + DE+VEVP +G R PR ++RQ L VIEPR EL Sbjct 246 LRTPTPDAEEIKLRYGVAKQVLARPDEAVEVPGLGDRGPRQVKRQALGAVIEPRVEELFT 305 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 L+ Q+ +R G + LA+G+VLTGG+AQ+ G+ A+ VF VR+ P Sbjct 306 LI-------QQVVRDSGYEDLLASGVVLTGGSAQMPGMIELAEDVFLKPVRVAVPEYEGS 358 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 L D + P +ST +GLL + L G + T + + + R+ W Sbjct 359 LADVMRNPRFSTVMGLLQEARMQRLRGRKVAAQ--TGNFKTLLARMKEWF 406 >gi|88937535|ref|ZP_01143097.1| Cell division protein FtsA [Geobacter uraniumreducens Rf4] gi|88915717|gb|EAR34974.1| Cell division protein FtsA [Geobacter uraniumreducens Rf4] Length=411 Score = 504 bits (1301), Expect = 2e-141, Method: Composition-based stats. Identities = 181/419 (43%), Positives = 277/419 (66%), Gaps = 8/419 (1%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + A L+VGL+IGT K+ A+VG + +G ++I+G+G+ PSRG+ KG V ++ES V + Sbjct 1 MSAKRDNLIVGLDIGTTKICAIVGNLTEEG-IDIVGIGTSPSRGLRKGVVINIESTVASI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+++AELMA C+I SVY ++G HI N G++ I EV +DV+ V+ AK++ + Sbjct 60 RKAVEEAELMAGCEIKSVYAGIAGGHIKGFNSQGVIAIKNREVCSDDVKRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H++PQE+ ID Q+GI+ P+G+SGVR++AKVH++T A+NI+K+ R GL Sbjct 120 PMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEAKVHIVTGAVASAQNIIKSCNRAGLD 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE+ELGV +VD+GGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEQLASSEAVLSADEKELGVALVDVGGGTTDIAIFVDGAIKHTSVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GC + S+VGKDE++EVPSVGGR PR L RQ L+E++EPR Sbjct 240 DIAVGLRTPMAEAEKIKQKYGCCMASLVGKDETIEVPSVGGRKPRILSRQLLSEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G++ +A+G+V+TGG+ +EG+ A++VF+ VR G P Sbjct 300 EEIFTLVNREIV-------KSGLEDLIASGVVITGGSTILEGMPELAEQVFNLPVRRGLP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GL D P Y+T VGL+ YG ++ E + +R+ W + F Sbjct 353 QRIGGLVDVVNSPAYATGVGLVVYGSKNVGVHEFPSAQSEDNIFRKVSRRMKEWFGEFF 411 >gi|39985101|gb|AAR36456.1| Gene info cell division protein FtsA [Geobacter sulfurreducens PCA] gi|39998155|ref|NP_954106.1| Gene info cell division protein FtsA [Geobacter sulfurreducens PCA] Length=411 Score = 504 bits (1300), Expect = 2e-141, Method: Composition-based stats. Identities = 188/419 (44%), Positives = 275/419 (65%), Gaps = 8/419 (1%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + L+VGL+IGT K+ A+VG V DG ++I+G+G+ PSRGM KG V ++ES V+ + Sbjct 1 MSGRRDNLIVGLDIGTTKICAIVGNVTEDG-IDIVGIGTSPSRGMRKGVVINIESTVESI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+ +AELMA C I SVY ++G HI N G++ I EV+ EDV+ V+ AK++ + Sbjct 60 KKAVSEAELMAGCDIRSVYAGIAGGHIKGINSQGVIAIKNREVSSEDVKRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H++PQE+ ID Q+GI+ P+G+SGVR++A+VH++T A+NI+KA R GL Sbjct 120 PMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEARVHIVTGAVASAQNIIKACNRAGLD 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS SVL+ DE+ELGV ++DIGGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEQLASSESVLSADEKELGVALIDIGGGTTDIAIFVDGAIKHTAVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GC + S+VGKDE++EVPSVGGR PR L RQ LAE++EPR Sbjct 240 DIAVGLRTPMAEAEKIKQKYGCCMASMVGKDETIEVPSVGGRKPRVLSRQLLAEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G + +A+GIV+TGG +EG+ A++VF+ VR G P Sbjct 300 EEIFTLVNREIV-------KSGFEDLIASGIVITGGTTILEGMPELAEQVFNLPVRRGLP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GLTD P Y+T VGL+ YG ++ E + +R+ W + F Sbjct 353 QQIGGLTDVVNSPVYATGVGLVVYGSKNVGIREFPTAQTDENMFRRVTRRMKEWFGEFF 411 >gi|77545874|gb|ABA89436.1| Gene info cell division protein FtsA [Pelobacter carbinolicus DSM 2380] gi|77919791|ref|YP_357606.1| Gene info cell division protein FtsA [Pelobacter carbinolicus DSM 2380] Length=409 Score = 503 bits (1298), Expect = 5e-141, Method: Composition-based stats. Identities = 179/419 (42%), Positives = 271/419 (64%), Gaps = 10/419 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + L+VGL+IGT K+ A+VG DG ++I+G+G+ PSRG+ KG V ++ES V+ + Sbjct 1 MSNNKNDLIVGLDIGTTKICAIVGHQNEDG-LDIVGIGTSPSRGLRKGVVINIESTVEAI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+ +AELMADC+I SVY ++G HI N G++ I EV +D+ V+ AK++ + Sbjct 60 RKALTEAELMADCKIDSVYAGIAGGHIRGFNSQGVIAIKTREVLHDDIRRVLDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+H +PQEY ID Q+GI +P+G+ GVR++AKVH++T A+NIV++ + ++ Sbjct 120 PMDREVIHTLPQEYIIDDQDGILDPLGMCGVRLEAKVHIVTAATASAQNIVRSCYKADVE 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE++LGV +VDIGGGT DIA++ GA++HT V+ GN +T+ Sbjct 180 VSDIVLEQLASSEAVLSTDEKDLGVALVDIGGGTTDIAIFIDGAIKHTSVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK ++GCA+ S+VGKDE++EVPSVGGR PR L R LAE++EPR Sbjct 240 DIAVGLRTPMAEAEVIKQKYGCAMTSMVGKDETIEVPSVGGREPRVLSRHLLAEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LV EI+ + G + LA+GIVLTGG+ + G+ A+++F+ VR G P Sbjct 300 EEIFTLVQREII-------KSGFEDLLASGIVLTGGSCILPGMPEMAEQIFNLPVRRGLP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GLTD P Y+T VGL+ +G G + + ++R+ W + F Sbjct 353 QGIGGLTDVVNSPIYATGVGLVKFGARCG--GATKFKMGSDNLFDRVLRRMKEWFVEFF 409 >gi|71163927|gb|EAO13642.1| Cell division protein FtsA [Xylella fastidiosa Dixon] gi|71275118|ref|ZP_00651405.1| Cell division protein FtsA [Xylella fastidiosa Dixon] Length=411 Score = 503 bits (1298), Expect = 5e-141, Method: Composition-based stats. Identities = 191/421 (45%), Positives = 281/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDY-QEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVCNPVHASGVGLLLMGSQMERPRRPSL---PTGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|28199731|ref|NP_780045.1| Gene info cell division protein [Xylella fastidiosa Temecula1] gi|28057852|gb|AAO29694.1| Gene info cell division protein [Xylella fastidiosa Temecula1] gi|71898199|ref|ZP_00680373.1| Cell division protein FtsA [Xylella fastidiosa Ann-1] gi|71731938|gb|EAO33995.1| Cell division protein FtsA [Xylella fastidiosa Ann-1] Length=411 Score = 502 bits (1295), Expect = 1e-140, Method: Composition-based stats. Identities = 191/421 (45%), Positives = 281/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDY-QEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + P +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVGNPVHASGVGLLLMGSQMERPRRPSL---PTGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|86160195|ref|YP_466980.1| Gene info cell division protein FtsA [Anaeromyxobacter dehalogenans 2CP-C] gi|85776706|gb|ABC83543.1| Gene info cell division protein FtsA [Anaeromyxobacter dehalogenans 2CP-C] Length=410 Score = 502 bits (1294), Expect = 1e-140, Method: Composition-based stats. Identities = 185/418 (44%), Positives = 276/418 (66%), Gaps = 10/418 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 A ++VGL+IGT K+ A+VGEV DG ++IIG+GS PS+G+ KG V ++++ V ++R Sbjct 2 AKSGDILVGLDIGTTKICAIVGEVTDDGSIDIIGIGSHPSKGLRKGVVVNIDATVASIKR 61 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 AI++AE MA C+I++VY ++G HI G+V + ++EV Q+DV+ V+ AK+V + Sbjct 62 AIEEAEHMAGCEITTVYTGIAGGHIKAFPSHGVVAVKDKEVRQQDVDRVIDQAKAVAIPL 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + V+HV+PQE+ +D Q+G+K PVG+SGVR++AK ++T A+NIVK +R GL V Sbjct 122 DREVIHVLPQEFVVDDQDGVKEPVGMSGVRLEAKALIVTGAVSSAQNIVKCAQRTGLNVA 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LASS + L+EDE+ELGVC+VD+GGGT DIA++ G+++HT VI GN +T+D+ Sbjct 182 DIVLQPLASSLATLSEDEKELGVCLVDVGGGTTDIAIFHNGSIQHTAVISLGGNHLTNDV 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A TP +AE IK ++GCA+ S+V K E++EVPSVGG PR L R LAE++EPR E Sbjct 242 AVGLRTPTHEAERIKKQYGCAMASMVDKTETIEVPSVGGGQPRVLSRHILAEIVEPRVEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + LV EI ++ G++ LA+G+V+TGG+ + G+ A+ V VR G P Sbjct 302 IFMLVQHEI-------QKCGMEEILASGVVITGGSTLLAGMPEMAEEVLGVPVRRGMPRG 354 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIK-RLNSWLRKEF 420 I GL D + P Y+TAVGL+ YG +H E+ K +V +K R+ WL + F Sbjct 355 IGGLVDVVKSPMYATAVGLVIYG--AHQQDESPYFKIRDENVYRKVKVRMKEWLGQIF 410 >gi|9105699|gb|AAF83611.1| Gene info cell division protein [Xylella fastidiosa 9a5c] gi|15837403|ref|NP_298091.1| Gene info cell division protein [Xylella fastidiosa 9a5c] Length=411 Score = 498 bits (1285), Expect = 1e-139, Method: Composition-based stats. Identities = 190/421 (45%), Positives = 280/421 (66%), Gaps = 11/421 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + ++ L+VGL+IGT+KV ALVGE ++ +IG+GS SRG+ +G V D+ES V+ Sbjct 1 MNRKGEKSLIVGLDIGTSKVVALVGEYSQGNLIEVIGIGSHESRGIKRGVVVDIESTVQS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRA+++AELMA C+I SVY ++SG H+ C+N G+ PI + EVT D+E V+ AK+V Sbjct 61 IQRAVEEAELMAGCEIRSVYASISGNHVQCKNSQGIAPIRDGEVTWNDLERVLDAAKAVA 120 Query 121 VRDEHRVLHVIPQEYAIDY-QEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + R+LH IP+EY +D QEGI+NPVG++GVR++ HL+ C A NI+K V +CG Sbjct 121 IPADQRILHAIPREYVLDDSQEGIRNPVGMTGVRLEVHAHLVVCAQSAAANIIKCVHKCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VD L+ + L S+ +VLT DERELGV +VDIG GT D+AVY GA+ HT +P AG+ V Sbjct 181 LQVDDLVLSSLGSAVAVLTSDERELGVVLVDIGAGTTDLAVYVHGAICHTASLPIAGDHV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 T+DIA+ TP +AE IKVR+ CAL + +ES++VPSVG RPPR + R +LA+ ++ Sbjct 241 TNDIAHMLRTPTPEAEQIKVRYACALAQMAMAEESIQVPSVGDRPPRRMPRASLAQAVQG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+ +V Q +LR+ G + + AG+VLTGGA+++EG+ A+ + VR+G Sbjct 301 RYEEIFEMV-------QAELRRSGFEELVRAGMVLTGGASKMEGVVELAEEMLQMPVRVG 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ++TGL + +++ VGLL G + + T VG++ K+L +W R E Sbjct 354 IPQHVTGLGEVVGNAVHASGVGLLLMGSQMERPRRPSL---PTGRVGAFFKKLKNWYRGE 410 Query 420 F 420 F Sbjct 411 F 411 >gi|33517282|emb|CAD83666.1| Gene info cell division protein FtsA [Candidatus Blochmannia floridanus] gi|33519619|ref|NP_878451.1| Gene info cell division protein [Candidatus Blochmannia floridanus] Length=420 Score = 498 bits (1284), Expect = 2e-139, Method: Composition-based stats. Identities = 310/422 (73%), Positives = 371/422 (87%), Gaps = 4/422 (0%) Query 1 MIKAT-DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59 MIK + ++KL+VGLEIGTAKVA L+GE+LPD M+NIIG+G C S+GMDKGGVN+LESV+K Sbjct 1 MIKVSDNKKLLVGLEIGTAKVATLIGEILPDSMINIIGMGCCASQGMDKGGVNNLESVIK 60 Query 60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119 CV+ +I+QAE M+ CQI+SVYL+LSGKHISC+NEIGMV ISEEEVTQ DV+NVVH AKSV Sbjct 61 CVEYSINQAESMSGCQITSVYLSLSGKHISCKNEIGMVSISEEEVTQSDVDNVVHIAKSV 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 ++ DEHR+LHVIPQ+Y+IDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG Sbjct 121 KMSDEHRILHVIPQDYSIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L+VDQLIF+GL+SSY+VLT+DERELGVCVVD+GGGTMDIA+YT GALR+ KVIPYAGNVV Sbjct 181 LRVDQLIFSGLSSSYAVLTQDERELGVCVVDLGGGTMDIAIYTAGALRYIKVIPYAGNVV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 TSDIAYAFGTP S AE+IK+R+GCAL S+V +DE++EVPSVGGRPPR LQR LAE+IEP Sbjct 241 TSDIAYAFGTPLSAAESIKLRYGCALESLVDRDENIEVPSVGGRPPRILQRYMLAEIIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY EL+NLVN+EILQLQ +L+Q +KHHLAAG+VLTGGA+ I+GL ACAQ+VFH QVRI Sbjct 301 RYVELMNLVNKEILQLQSQLKQFNIKHHLAAGVVLTGGASMIDGLVACAQKVFHNQVRIA 360 Query 360 APLNITG-LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 + +NI G + D + P YST +GLLHYGKESHLN + + + +WIK++N WL+K Sbjct 361 SSINILGSIDDDIRGPQYSTVIGLLHYGKESHLN--DDADIDKKIKIKNWIKKINGWLKK 418 Query 419 EF 420 EF Sbjct 419 EF 420 >gi|87122623|ref|ZP_01078500.1| cell division protein FtsA [Marinomonas sp. MED121] gi|86162081|gb|EAQ63369.1| cell division protein FtsA [Marinomonas sp. MED121] Length=420 Score = 496 bits (1279), Expect = 8e-139, Method: Composition-based stats. Identities = 188/427 (44%), Positives = 282/427 (66%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++VGL++GT+KV LVGEV+ DG + I+G+GS ++GM +G V ++ES V+ +QRA+++A Sbjct 1 MIVGLDVGTSKVVCLVGEVMADGRLEIVGIGSHAAKGMKRGAVINIESTVQSIQRAVEEA 60 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 ELMA C I SVY++++G HI N G+V + + EV + D+E V+ A++V + + RVL Sbjct 61 ELMAGCNIHSVYVSVAGSHIRSLNSHGIVAVKDGEVHEADIERVIDAAQAVPIPSDQRVL 120 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 H++PQEY+ID QEGIK+P G+SGVR++A VHLI+ + NI K ++RCGL VD +I + Sbjct 121 HILPQEYSIDSQEGIKDPSGMSGVRLEANVHLISGAANAVMNIEKCIKRCGLGVDGVILS 180 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS+S L++DE++LGVC+VDIG GT D+AV+ GA+ HT V+P AG+ VT+DI+ A Sbjct 181 QLASSHSSLSDDEKDLGVCLVDIGAGTADMAVWIDGAIHHTSVVPVAGDQVTNDISMALR 240 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 TP AE IKV++ CAL S+ G D+++EVPSVG R RS+ R LAEV+E RY E+ +LV Sbjct 241 TPTQHAENIKVQYACALSSLAGADQNIEVPSVGDRQSRSISRHALAEVVEARYEEIFSLV 300 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLT 368 +E LR+ G + AGIV+TGG + +EG A+RVF VR+ P+++ G++ Sbjct 301 LDE-------LRRSGYAERIPAGIVVTGGTSLMEGATELAERVFDMPVRMSVPVSVKGMS 353 Query 369 DYAQEPYYSTAVGLLHYG--------KESHLNG-------EAEVEKRVTASVGSWIKRLN 413 D P +ST VGL+ YG + H++ + + + + + Sbjct 354 DIVDNPIFSTGVGLIMYGIDESDLGMAQQHVSSLKVEESKHSVKSESTAEAANKMWRNMK 413 Query 414 SWLRKEF 420 SW++ F Sbjct 414 SWVKSNF 420 >gi|46450324|gb|AAS96972.1| Gene info cell division protein FtsA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] gi|46580904|ref|YP_011712.1| Gene info cell division protein FtsA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] Length=408 Score = 495 bits (1276), Expect = 2e-138, Method: Composition-based stats. Identities = 182/417 (43%), Positives = 272/417 (65%), Gaps = 13/417 (3%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 L+VGL+IGT K+ A+VGE DG V+I+G+G+ PS G+ KG V ++E V+ +++ Sbjct 1 MAKTDLIVGLDIGTTKICAVVGEATADG-VDIVGIGTSPSTGLRKGVVVNIEQTVQSIKK 59 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A+++AELMA C+I SVY ++G HI N G++ + EV +D+E + AK+V + Sbjct 60 ALEEAELMAGCEIRSVYAGIAGSHIKGFNSHGVIAVKGGEVGPKDIERALDAAKAVAIPL 119 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + V+H++PQEY +D Q GI +P+G++GVR++ KVH++T A+NIV++ R GL V Sbjct 120 DREVIHILPQEYVVDDQRGIADPLGMAGVRLEVKVHIVTGAVTSAQNIVRSCHRSGLDVS 179 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LASS +VLTE+ERE+GV +VD+GGGT DIAV+ +++HT V+ G +T+DI Sbjct 180 DIVLEALASSKAVLTEEEREIGVALVDLGGGTTDIAVFANDSIKHTGVLALGGQNLTNDI 239 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A+ TP AE IKV++GCA+ +V DE +EVPSVGGR PR L RQ LAE+ EPR E Sbjct 240 AFGLRTPMISAEKIKVKYGCAMAEMVRNDELIEVPSVGGREPRRLSRQVLAEICEPRMEE 299 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L+LV++E++ + G K+ + +G+VLTGG A IEG +++F+ RIG P N Sbjct 300 ILSLVDQELV-------RSGFKNQIGSGVVLTGGTALIEGCQELGEQIFNMPTRIGYPRN 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + GL D P ++TAVGLL YG E + +E + G+ R+ S +RK F Sbjct 353 VGGLKDVVNSPKFATAVGLLRYGAE-----KEGLELKFRIRDGNVFNRVLSRMRKWF 404 >gi|68177554|ref|ZP_00550701.1| Cell division protein FtsA [Desulfuromonas acetoxidans DSM 684] gi|67982376|gb|EAM71783.1| Cell division protein FtsA [Desulfuromonas acetoxidans DSM 684] Length=409 Score = 491 bits (1267), Expect = 2e-137, Method: Composition-based stats. Identities = 178/420 (42%), Positives = 277/420 (65%), Gaps = 12/420 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + L+VGL+IGT K+ A++ + G ++I+G+G+ SRG+ KG V ++ES V+ + Sbjct 1 MSNRKENLIVGLDIGTTKICAIIASMTDSG-LDIVGIGTSVSRGLRKGVVINIESTVEAI 59 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A+ +AELMA C+I+SV+ ++G HI+ N G++ I EVT EDV+ V+ AK++ + Sbjct 60 KKALQEAELMAGCEINSVFAGIAGAHITGFNSQGVIAIKNREVTSEDVQRVIDAAKAIAI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + V+HVIPQE+ ID Q+GIK P+G+SGVR+++KVH++T A+NIVK+ + + Sbjct 120 PMDREVIHVIPQEFIIDDQDGIKEPLGMSGVRLESKVHIVTGAVASAQNIVKSCNKASVN 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V ++ LASS +VL+ DE+ELGV +VDIGGGT D+A++ GA++HT V+ GN +T+ Sbjct 180 VADIVLEPLASSEAVLSADEKELGVAIVDIGGGTTDLAIFVDGAIKHTAVLSLGGNHLTN 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DIA TP ++AE IK +G L S +GKDE++EVPSVGGR PR L RQ LAE++EPR Sbjct 240 DIAVGLRTPMAEAERIKHAYGSCLTSDIGKDETIEVPSVGGREPRILSRQLLAEILEPRV 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LVN EI+ + G + +A+G+V+TGG + + G+ A+++F+ VR G P Sbjct 300 EEIFTLVNREIV-------RSGFEDLIASGVVITGGTSILPGMPELAEQIFNLPVRRGVP 352 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESH-LNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GL D P Y+T VGL+ YG ++ +N + +++V V ++R+ W + F Sbjct 353 QGIGGLIDVVNSPIYATGVGLVIYGSKNQEINNFSIGQEKVFDKV---MRRMKEWFGEFF 409 >gi|88794391|ref|ZP_01110099.1| cell division protein FtsA [Alteromonas macleodii 'Deep ecotype'] gi|88774157|gb|EAR05414.1| cell division protein FtsA [Alteromonas macleodii 'Deep ecotype'] Length=452 Score = 489 bits (1262), Expect = 7e-137, Method: Composition-based stats. Identities = 226/374 (60%), Positives = 294/374 (78%), Gaps = 7/374 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K +R L+VGL+IGT++V A+VGE+L D ++I+GVG+ S+GMDKGGVNDL VVK Sbjct 81 MSKPAERNLIVGLDIGTSQVKAVVGELLEDDQISIVGVGTHASKGMDKGGVNDLNLVVKS 140 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRA+++ ELMADC++SSV++++SG+H+ CQNE GMVPI+ +EVTQEDV+NV+H A+SV Sbjct 141 VQRAVNEMELMADCRVSSVFMSISGRHVKCQNENGMVPINNQEVTQEDVDNVIHAARSVP 200 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + E R+LHV+PQE+ ID QEGIKNP+G+SGVRM+A H+ITC +DMAKN+VK VERC L Sbjct 201 IAAERRLLHVLPQEFTIDVQEGIKNPIGMSGVRMEADAHIITCADDMAKNMVKCVERCEL 260 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 DQLIF+ LASSY+VLT+DERELGVCVVDIGGGTMD+ +YT GA+RHT VIP AGN +T Sbjct 261 NADQLIFSALASSYAVLTDDERELGVCVVDIGGGTMDMVIYTDGAIRHTAVIPVAGNQIT 320 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIA F TP S+AE IKV + CAL +V ++S+EVPSVGGRP R + R TLAEVIEPR Sbjct 321 SDIAKIFRTPISNAEEIKVNYACALKDMVSMEDSIEVPSVGGRPARVMSRHTLAEVIEPR 380 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y EL LV++EI R G++ +AAG+VLTGG A++EG A+ +F VR+G Sbjct 381 YQELFELVHDEI-------RASGLEEQIAAGLVLTGGTAKMEGAVEFAEELFQMPVRVGK 433 Query 361 PLNITGLTDYAQEP 374 P+N+ GL++Y + Sbjct 434 PINVKGLSEYVDDA 447 >gi|78218498|gb|ABB37847.1| Gene info cell division protein FtsA [Desulfovibrio desulfuricans G20] gi|78356093|ref|YP_387542.1| Gene info cell division protein FtsA [Desulfovibrio desulfuricans G20] Length=408 Score = 489 bits (1261), Expect = 8e-137, Method: Composition-based stats. Identities = 178/417 (42%), Positives = 270/417 (64%), Gaps = 13/417 (3%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 L+VGL+IGT K+ +VGE +G ++I+G+G+ PS G+ KG V ++E V+ +++ Sbjct 1 MAKSDLIVGLDIGTTKICCVVGEPTEEG-IDIVGIGTSPSTGLRKGVVVNIEQTVQSIKK 59 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A+++AELMA C+I SVY ++G HI N G++ + EV DVE V+ AK++ + Sbjct 60 ALEEAELMAGCEIRSVYAGIAGSHIKGANSDGVIAVKGGEVAPRDVERVLDAAKALNIPM 119 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + V+H++PQEY +D Q GI +P+G++GVR++ KVH++T A+NIV++ R GL V Sbjct 120 DREVIHILPQEYIVDEQRGIADPLGMAGVRLEVKVHIVTGAVASAQNIVRSCHRSGLDVS 179 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LASS +VLTE+ERE+GV +VD+GGGT DIAV+ +++HT V+ G +T+DI Sbjct 180 DIVLEALASSKAVLTEEEREIGVALVDLGGGTTDIAVFANDSIKHTGVLALGGQNLTNDI 239 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A+ TP + AE IK+++GCA+ +V DE +EV SVG R PR L RQ LAE+ EPR E Sbjct 240 AFGLRTPMASAEKIKIKYGCAMAEMVRDDEGIEVASVGDREPRRLSRQVLAEICEPRMEE 299 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L+LV++E+++ G K+ + AG+VLTGG A IEG +++F+ RIG P N Sbjct 300 ILSLVDQELVRY-------GFKNMIGAGVVLTGGTALIEGCQELGEQIFNLPTRIGYPRN 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + GL D P ++TAVGLL YG E + +E + G+ R+ S +RK F Sbjct 353 VGGLKDVVNSPKFATAVGLLCYGAE-----KEGLELKFRIRDGNMFNRVLSRMRKWF 404 >gi|71548015|ref|ZP_00668508.1| Cell division protein FtsA [Syntrophobacter fumaroxidans MPOB] gi|71486461|gb|EAO18965.1| Cell division protein FtsA [Syntrophobacter fumaroxidans MPOB] Length=406 Score = 483 bits (1244), Expect = 8e-135, Method: Composition-based stats. Identities = 183/412 (44%), Positives = 265/412 (64%), Gaps = 11/412 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 +L+VGL++GT KV A+VGEV +G ++I+GVG+ PS G+ G V +++ V +++A Sbjct 3 KREELIVGLDLGTTKVCAVVGEVTSEG-MDIVGVGTYPSIGLRGGVVVNIDQTVHSIRKA 61 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 +++AELMA C+ISSVY ++G H+ N G++ I EVTQ D++ V+ AK+V + + Sbjct 62 VEEAELMAGCEISSVYAGVAGTHVQSLNSHGVIAIKSREVTQADIDRVLDAAKTVALPFD 121 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++LHV+PQ+Y +D QEGI+NP G++GVR++AKVH+IT +NIVK ER GL+V Sbjct 122 RQILHVLPQQYIVDDQEGIQNPTGMAGVRLEAKVHIITGAIAAVQNIVKCCERAGLQVQD 181 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASS SVL DER LGV +VD+GGGT DIAV+ A+R++ V+ GN +TSDI+ Sbjct 182 VVLESLASSESVLDMDERHLGVALVDLGGGTSDIAVFMDHAIRYSCVVGLGGNHITSDIS 241 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +AE IK +HGCAL V + + +EV SVGG+ PR L R LA+++E R E+ Sbjct 242 VGLRTSIDEAEKIKKKHGCALVEWVNQQDMIEVGSVGGQKPRQLARSVLAQIVEARVEEI 301 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 + ++ E++ + G L AG+VLTGG + + G+ A++VF VRIG P N Sbjct 302 VKIIEWELV-------RSGYVESLHAGVVLTGGVSLLPGIRELAEKVFDLPVRIGVPYNF 354 Query 365 TGLTDYAQEPYYSTAVGLLHYGKESHLNG---EAEVEKRVTASVGSWIKRLN 413 GL D + P Y+TA GLL YGK+ G E V K+V ASV W K Sbjct 355 GGLGDVVKNPIYATATGLLLYGKKHGNRGPMEEPSVIKKVLASVRRWFKEFW 406 >gi|68057890|gb|AAX88143.1| Gene info cell division protein FtsA [Haemophilus influenzae 86-028NP] gi|68249691|ref|YP_248803.1| Gene info cell division protein FtsA [Haemophilus influenzae 86-028NP] gi|46133310|ref|ZP_00156982.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus influenzae R2866] gi|46129003|ref|ZP_00155596.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus influenzae R2846] Length=425 Score = 479 bits (1234), Expect = 1e-133, Method: Composition-based stats. Identities = 225/425 (52%), Positives = 311/425 (73%), Gaps = 5/425 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K + K +VGLE+GT+KV A+VGEV PDG+VN++GVGSCPS+G+D+G + DL++VV Sbjct 1 MVKGVETKTIVGLEVGTSKVVAVVGEVFPDGVVNVLGVGSCPSKGIDRGSITDLDAVVGS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE MADCQI SV LA++G+HI NE G VPI+E EVTQE++++ +HTA S++ Sbjct 61 IQRAIEAAESMADCQIMSVTLAITGEHIQSLNESGFVPIAESEVTQEEIDSALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q IKNP+GL GVR++A+VHLI CH D N+ KAVERCGL Sbjct 121 LPEGLSLLHVIPQEYAVDRQMNIKNPLGLQGVRLKAQVHLIACHQDWQNNLKKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+++F+G A+++SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN+VT Sbjct 181 QVDKVVFSGFAATHSVLTEDEKDLGVCLIDFGAGTMNVMVYTNGALRFSKVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGS-IVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA+A ++AE IKV + A + D+ +EV S+GGR PRSL + L+ + Sbjct 241 NDIAHACTISRAEAERIKVNYASAFYPARLHGDKKIEVASIGGRAPRSLTKSDLSLITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RYTELL +V +E+ +L+ +L + +K L AG+V+TGG AQIE L CA VFH QVRI Sbjct 301 RYTELLGVVKDELDKLKAELEAKHIKFELIAGVVITGGGAQIEDLKECASNVFHCQVRIA 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESH----LNGEAEVEKRVTASVGSWIKRLNSW 415 +PLNITGLTDY P YST VGLL Y + ++G + E S+ +K++ + Sbjct 361 SPLNITGLTDYVNRPQYSTVVGLLQYNHSNSDDDLISGSDDSEGTFFESIWQGVKKIVNK 420 Query 416 LRKEF 420 +R EF Sbjct 421 VRSEF 425 >gi|74024661|ref|ZP_00695194.1| Cell division protein FtsA [Rhodoferax ferrireducens DSM 15236] gi|72602629|gb|EAO38668.1| Cell division protein FtsA [Rhodoferax ferrireducens DSM 15236] Length=409 Score = 477 bits (1230), Expect = 3e-133, Method: Composition-based stats. Identities = 189/414 (45%), Positives = 267/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV +V EVLP+G + + G+G PS G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTAKVMVVVAEVLPNGALKLAGLGVAPSNGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I+ VY ++G HI N GMV I + EV+ DV VV TAK++ + + R Sbjct 66 EAELMADCKITRVYTGITGSHIRGINSHGMVAIKDREVSAADVARVVETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ +K PVG+SG+R++AKVH++T A+NI+K V RCGL+V+QL+ Sbjct 126 LLLVEPQEFIIDGQD-VKEPVGMSGIRLEAKVHIVTGAQSAAENIIKCVRRCGLEVEQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLTEDERELGV +VDIG GT DIA++T GA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSLSVLTEDERELGVALVDIGAGTTDIAIFTNGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV G A + + VEVP +G R PR L RQ LA VIEPR E+ + Sbjct 245 LRTPTKDAEEIKVESGYAKQLLADPEAQVEVPGLGDRGPRMLSRQALAGVIEPRVEEIFS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ +R+ G + L++GIVLTGG+ + G+ + +F VR G P + Sbjct 305 LVHQ-------VMRESGFEEMLSSGIVLTGGSCVMPGMVELGEDIFLKPVRRGIPKYSSA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L D +P +T +GLL + + L G +K S+ + ++ W F Sbjct 358 LADMVAQPRAATVMGLLEEARMARLRGFKVAQK--NGSMKNAFGQVKDWFVGNF 409 >gi|47574472|ref|ZP_00244508.1| COG0849: Actin-like ATPase involved in cell division [Rubrivivax gelatinosus PM1] Length=409 Score = 474 bits (1223), Expect = 2e-132, Method: Composition-based stats. Identities = 181/414 (43%), Positives = 267/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGTAKV A+V EVLP+G + + G+G+ P+ G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTAKVMAVVAEVLPEGELRVAGIGTAPAHGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AE+MADC+I+ VY ++G HI QN GMV + ++EVT DV V+ TAK++ + ++ R Sbjct 66 EAEMMADCKITRVYTGITGSHIRGQNSTGMVIVRDKEVTPVDVARVIETAKAINIPNDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V QE+ ID E +K P+G+SG R++ KVH++T A+NI+K V RCGL+VD L+ Sbjct 126 MLLVEAQEFVIDGHE-VKEPIGMSGGRLEVKVHIVTGAQSAAENIIKCVRRCGLEVDMLV 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 ASS++VLT+DE++LGV +VDIG GT D++++T G++RHT VIP AG+++TSDIA A Sbjct 185 LNPSASSHAVLTDDEKDLGVALVDIGAGTTDVSIFTDGSVRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV HG A + +E VEVP +G R PR L RQ LA VIEPR E+ + Sbjct 245 LRTPTKDAEEIKVEHGVAKQLLADPNEQVEVPGLGDRGPRMLSRQALAGVIEPRVEEIFS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV++ I R+ G + L++GIVLTGG A + G+ + +F VR G P Sbjct 305 LVHQVI-------RESGYEELLSSGIVLTGGTAVMPGMVELGEDIFLKPVRKGLPTYAGA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D P +T +GLL + + G ++ SV + R+ W F Sbjct 358 LSDMVASPRSATVMGLLEEARLARTRGMKAAQQ--AGSVQTLFGRVKDWFIGNF 409 >gi|10038895|dbj|BAB12930.1| Gene info cell division protein ftsA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] gi|15616832|ref|NP_240044.1| Gene info cell division protein FtsA [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] gi|11132267|sp|P57309|FTSA_BUCAI Cell division protein ftsA gi|25300213|pir||B84955 cell division protein ftsA [imported] - Buchnera sp. (strain APS) Length=418 Score = 472 bits (1218), Expect = 8e-132, Method: Composition-based stats. Identities = 234/420 (55%), Positives = 327/420 (77%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + DRKLVVGLEIGT KV LVGEVL D + IIG G+C S+G+DKG +N+L+ +V C Sbjct 1 MIISKDRKLVVGLEIGTTKVVTLVGEVLIDDNIKIIGFGTCLSKGIDKGKINNLDLIVSC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +Q +I++AE+MADCQI+SVYL+LS K+I+CQNEIG++PIS++EVT+ED+E+V+H A+SV+ Sbjct 61 IQESINKAEIMADCQITSVYLSLSNKYINCQNEIGIIPISDDEVTKEDIEHVIHIAQSVQ 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSGVRMQ KVHLITCH +MA+NI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQYGIKNPIGLSGVRMQVKVHLITCHQNMARNIIKAVEKCDV 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE LGVC++DIGGGT+D +Y G++++++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECNLGVCMIDIGGGTIDFTIYIDGSIKYSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDI+YAF T +AE IK+++G +G ++++ + ++LQ+ L +VIE R Sbjct 241 SDISYAFSTSRDNAENIKIKYGSVKKPPLGSSKNIDFSDINCNFQQNLQQDALIDVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+LV ++I+ LQ+KL ++G K+ L +GIVLTGG + I L CA++VF +VR+ Sbjct 301 YVELLSLVQDQIVHLQKKLHKKGEKYELLSGIVLTGGGSNISCLTDCAEKVFQKKVRVAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P NI+GL + EP YST +GLLHYGKES++N + +K+ + KR+N+W +KEF Sbjct 361 PFNISGLIEKITEPCYSTVIGLLHYGKESYIN--IDKKKKEHSFFEIIFKRINNWFKKEF 418 >gi|1169751|sp|P45068|FTSA_HAEIN Cell division protein ftsA gi|1574698|gb|AAC22797.1| Gene info cell division protein (ftsA) [Haemophilus influenzae Rd KW20] gi|16273068|ref|NP_439300.1| Gene info cell division protein [Haemophilus influenzae Rd KW20] Length=425 Score = 472 bits (1217), Expect = 1e-131, Method: Composition-based stats. Identities = 224/425 (52%), Positives = 310/425 (72%), Gaps = 5/425 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M+K + K +VGLE+GT+KV +VGEV PDG+VN++GVGSCPS+G+D+G + DL++VV Sbjct 1 MVKGVETKTIVGLEVGTSKVVVVVGEVFPDGVVNVLGVGSCPSKGIDRGSITDLDAVVGS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE MADCQI SV LA++G+HI NE G VPI+E EVTQE++++ +HTA S++ Sbjct 61 IQRAIEAAESMADCQIMSVTLAITGEHIQSLNESGFVPIAESEVTQEEIDSALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q IKNP+GL GVR++A+VHLI CH D N+ KAVERCGL Sbjct 121 LPEGLSLLHVIPQEYAVDRQMNIKNPLGLQGVRLKAQVHLIACHQDWQNNLKKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD+++F+G A+++SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN+VT Sbjct 181 QVDKVVFSGFAATHSVLTEDEKDLGVCLIDFGAGTMNVMVYTNGALRFSKVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGS-IVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 +DIA+A ++AE IKV + A + D+ +EV S+GGR PRSL + L+ + Sbjct 241 NDIAHACTISRAEAERIKVNYASAFYPARLHGDKKIEVASIGGRAPRSLTKSDLSLITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RYTELL +V +E+ +L+ +L + +K L AG+V+TGG AQIE L CA VFH QVRI Sbjct 301 RYTELLGVVKDELDKLKAELEAKHIKFELIAGVVITGGGAQIEDLKECASNVFHCQVRIA 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHY----GKESHLNGEAEVEKRVTASVGSWIKRLNSW 415 +PLNITGLTDY P YST VGLL Y + ++G + E S+ +K++ + Sbjct 361 SPLNITGLTDYVNRPQYSTVVGLLQYNYSNSDDDLISGSDDSEGTFFESIWQGVKKIVNK 420 Query 416 LRKEF 420 +R EF Sbjct 421 VRSEF 425 >gi|85858530|ref|YP_460732.1| Gene info cell division protein [Syntrophus aciditrophicus SB] gi|85721621|gb|ABC76564.1| Gene info cell division protein [Syntrophus aciditrophicus SB] Length=409 Score = 471 bits (1215), Expect = 2e-131, Method: Composition-based stats. Identities = 180/417 (43%), Positives = 270/417 (64%), Gaps = 11/417 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 ++VGL+IGT K A+VGEV G ++IIG+GS PS G+ KG V +++S V+ ++ A Sbjct 3 MQGNVIVGLDIGTTKTCAIVGEVTDTG-IDIIGIGSHPSDGLRKGVVVNIDSTVEAIKAA 61 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 +++AE M+ C+I SV+ ++G HI QN +G+V + EV EDVE + AK++ + + Sbjct 62 VEEAERMSGCEIGSVFTGIAGGHIKAQNSLGIVAVKGREVGSEDVERAIEAAKAIAIPLD 121 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++LH +PQ Y +D Q+GIK+PVG+SGVR++AKVH++T +NI K+V R GL ++ Sbjct 122 RQILHTLPQSYVVDEQDGIKDPVGMSGVRLEAKVHVVTGVVTSIQNIEKSVTRVGLDIND 181 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LA+S +VL++DER+LGV ++DIGGGT +IAV+ G++RHT VIP GN VTSDIA Sbjct 182 IVLEQLAASQAVLSDDERDLGVALLDIGGGTTNIAVFWEGSIRHTAVIPVGGNYVTSDIA 241 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 TP ++AE IK+ GCA ++ K+E++EVPSVGGR PR + RQ L +IE R E+ Sbjct 242 TGLRTPLNEAEKIKIGFGCAYAPMIPKEETIEVPSVGGREPRVVSRQILGRIIEARMEEI 301 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 LN+ +EI+ + G + LAAG+VL GG A ++G+ +++F+ VR G P I Sbjct 302 LNMAYKEIV-------RSGYEDVLAAGVVLAGGTALLDGITELTEQIFNMPVRRGYPSGI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG-SWIKRLNSWLRKEF 420 GLTD P Y+T VGL+ YG ++ + V K G I + W+ + F Sbjct 355 GGLTDVVNSPMYATGVGLVLYGSKNL--AKVVVRKGEKGKAGDDVIAKFKKWILEFF 409 >gi|67848311|ref|ZP_00503429.1| Cell division protein FtsA [Polaromonas sp. JS666] gi|67781358|gb|EAM40972.1| Cell division protein FtsA [Polaromonas sp. JS666] Length=409 Score = 469 bits (1210), Expect = 7e-131, Method: Composition-based stats. Identities = 185/414 (44%), Positives = 269/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGT+KV A+V EV+P G + + G+G S G+ +G V ++++ V+ +Q+A+ Sbjct 6 KDLVVGLDIGTSKVMAVVAEVMPGGELKLAGLGIAASNGLKRGVVVNIDATVQSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+IS VY ++G HI N GMV + ++EVTQ DV V+ TAK++ + + R Sbjct 66 EAELMADCKISRVYTGITGSHIRGINSSGMVAVKDKEVTQADVARVIETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ ++ P+G+SG+R++AKVH++T A+NI+K V RCGL+VDQL+ Sbjct 126 LLLVEPQEFVIDGQD-VREPIGMSGIRLEAKVHIVTGAQSAAENIIKCVRRCGLEVDQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS +VLT+DE+ELGV +VDIG GT D+A++TGGA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSLAVLTQDEQELGVALVDIGAGTTDVAIFTGGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV G A + D VEVP +G R PR L +Q LA VIEPR E+ + Sbjct 245 LRTPTKDAEDIKVESGYAKQLLADPDTQVEVPGLGDRGPRMLSKQALAGVIEPRIEEIYS 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV + I R+ G + L++GIV+TGG+A + G+ + +F VR G P + Sbjct 305 LVQQVI-------RESGYEEVLSSGIVITGGSAVMPGMVELGEDIFLKPVRRGIPRYSSA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + +T +GLL + + + G +K SV + R+ W F Sbjct 358 LSDMVAQARAATVMGLLEEARLARMRGYKVAQK--AGSVHNAFGRVKDWFVGNF 409 >gi|21623112|gb|AAM67771.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Sg (Schizaphis graminum)] gi|22654234|sp|O51928|FTSA_BUCAP Cell division protein ftsA gi|21672493|ref|NP_660560.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Sg (Schizaphis graminum)] Length=418 Score = 469 bits (1208), Expect = 1e-130, Method: Composition-based stats. Identities = 241/420 (57%), Positives = 332/420 (79%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + +RKLVVGLEIGT KV LVGEVL +G + IIG+G C S G+DKG +N+L++V+ C Sbjct 1 MIISKNRKLVVGLEIGTTKVVTLVGEVLTNGKIKIIGIGICQSNGIDKGRINNLDAVISC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++ +I QAE+MA+CQI+SVYL+LS K+I+CQNEIG+VPISE+EVT+ED+ENV+HTAKSV+ Sbjct 61 IRESIHQAEIMANCQITSVYLSLSSKYINCQNEIGIVPISEDEVTKEDIENVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSG RMQ +VHLITCH +MAKNI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQSGIKNPIGLSGTRMQVRVHLITCHQNMAKNIIKAVEKCDI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE +LGVC++DIGGGT+D+ Y G+++ ++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECKLGVCMIDIGGGTIDLITYIDGSIQDSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DI+YAF T SD+E IK+++G A+ G +++++ S G ++LQ+ T+ EVIE R Sbjct 241 KDISYAFSTSYSDSEKIKIKYGSAIKLSPGTSKNIDLSSKYGNFQKNLQQDTVIEVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+L+N IL +Q+KL ++G K+ L GIVLTGGA+ I L CA+++F ++RI Sbjct 301 YNELLHLINNRILYVQKKLYKEGRKYQLTGGIVLTGGASTISFLTECAEKIFQKKIRIAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNI+GLTD EP+YST VGLLHYGKE + + +KR + + W +++++W +KEF Sbjct 361 PLNISGLTDNVTEPHYSTVVGLLHYGKEFYFDDT--NQKREISFIEKWFQKISNWFKKEF 418 >gi|84715213|ref|ZP_01022368.1| Cell division protein FtsA [Polaromonas naphthalenivorans CJ2] gi|84693336|gb|EAQ19137.1| Cell division protein FtsA [Polaromonas naphthalenivorans CJ2] Length=409 Score = 468 bits (1207), Expect = 2e-130, Method: Composition-based stats. Identities = 183/414 (44%), Positives = 267/414 (64%), Gaps = 10/414 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + LVVGL+IGT+K+ +V EV+P G + + G+G S+G+ +G V ++++ V +Q+A+ Sbjct 6 KDLVVGLDIGTSKIMVVVAEVMPGGQLKLAGLGIAASQGLKRGVVVNIDATVHSIQQALK 65 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126 +AELMADC+I V+ ++G HI N GMV + ++EVTQ DV V+ TAK++ + + R Sbjct 66 EAELMADCKIGRVFTGITGSHIRGINSSGMVAVKDKEVTQADVTRVIETAKAINISTDQR 125 Query 127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186 +L V PQE+ ID Q+ ++ P+G+SG+R++AKVH++T A+NI+K V RCGL+VDQL+ Sbjct 126 LLLVEPQEFVIDGQD-VREPIGMSGLRLEAKVHIVTGAQSAAENIIKCVRRCGLEVDQLM 184 Query 187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246 LASS SVLT+DE+ELGV +VDIG GT D+A++TGGA+RHT VIP AG+++TSDIA A Sbjct 185 LNPLASSQSVLTQDEQELGVAMVDIGAGTTDVAIFTGGAIRHTAVIPIAGDLITSDIAMA 244 Query 247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306 TP DAE IKV +GCA + D VEVP +G R PR L +Q LA VIEPR E+ Sbjct 245 LRTPTKDAEDIKVENGCAKQLLADPDTQVEVPGLGDRGPRMLSKQALAGVIEPRVEEIYL 304 Query 307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366 LV + I R+ G + L++GIV+TGG+A + G+ + +F VR G P Sbjct 305 LVQQVI-------RESGYEEVLSSGIVITGGSAMMPGMIELGEDIFLKPVRRGLPRYSGA 357 Query 367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 L+D + +T +GLL + + + G +K S+ S R+ W F Sbjct 358 LSDMVAQTRAATVMGLLEEARLARIRGFKVSQK--AGSMHSAFGRVKDWFVGNF 409 >gi|52307769|gb|AAU38269.1| Gene info FtsA protein [Mannheimia succiniciproducens MBEL55E] gi|52425717|ref|YP_088854.1| Gene info FtsA protein [Mannheimia succiniciproducens MBEL55E] Length=430 Score = 468 bits (1206), Expect = 2e-130, Method: Composition-based stats. Identities = 210/430 (48%), Positives = 298/430 (69%), Gaps = 10/430 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K +VGLE+GT+KV A+VGEVLPDG+VN++GVGSCPS+G+DKG + DL +VV Sbjct 1 MAKIVESKTIVGLEVGTSKVVAVVGEVLPDGVVNVLGVGSCPSKGIDKGSITDLAAVVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE +ADCQI SV LA++G+HI NE G VPI++ EVTQ++++ +HTA SV+ Sbjct 61 IQRAIEAAESVADCQIMSVTLAITGEHIQSLNESGFVPIADGEVTQDEIDQAMHTASSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + +LHVIPQEYA+D Q+ IKNP+GL GVR++A+ HLI H N+ KAVE CGL Sbjct 121 LPEGLSLLHVIPQEYAVDKQQNIKNPLGLQGVRLKAQAHLIAGHQAWVNNLQKAVETCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ++F+GLAS+YSVLTEDE++LGVC++D GGG+MDI VYT GALR++KV+PY GN +T Sbjct 181 KVDQVVFSGLASTYSVLTEDEKDLGVCLIDFGGGSMDIMVYTNGALRYSKVVPYGGNTIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVG-----KDESVEVPSVGGRPPRSLQRQTLAE 295 +A + T ++AE+IK+ +G A + +EV +GG PR+ + + E Sbjct 241 DFVAQSLTTSRNEAESIKINYGSAFMPSAELLEQFAKKKIEVAGLGGGAPRTFTKAQVVE 300 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 V Y +LL +V E+ QL+ +L +G+K L AG VLTGG++Q+ +A CA +F + Sbjct 301 VTSRCYHDLLQVVENELTQLRNELAMRGIKQELIAGFVLTGGSSQMTDIAKCATDIFESH 360 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKES-----HLNGEAEVEKRVTASVGSWIK 410 VR+G PLNITGLTDY +P Y+T +GLL Y + + G + E S+ K Sbjct 361 VRVGYPLNITGLTDYVNKPQYATVLGLLQYSHHNEEESTQMFGGSASESSFLGSIFEKCK 420 Query 411 RLNSWLRKEF 420 ++ + ++ EF Sbjct 421 KIANKVKSEF 430 >gi|7225649|gb|AAF40864.1| Gene info cell division protein FtsA [Neisseria meningitidis MC58] gi|15676338|ref|NP_273474.1| Gene info cell division protein FtsA [Neisseria meningitidis MC58] Length=414 Score = 467 bits (1205), Expect = 3e-130, Method: Composition-based stats. Identities = 172/419 (41%), Positives = 258/419 (61%), Gaps = 10/419 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 ++ + L+IGT+KV AL+GEV D +NI+G+G PSRG+ G V ++++ V+ +++A Sbjct 3 QQQRYISVLDIGTSKVLALIGEVQDDDKINIVGLGQAPSRGLRAGMVTNIDATVQAIRQA 62 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 ++ AELMAD +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + Sbjct 63 VNDAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++L + Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +ERCGLK DQ Sbjct 123 QKILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIERCGLKSDQ 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LAS +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ Sbjct 183 IMLQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLS 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 + TP AE IK+ +G A G E +EVP VG R R + + LA +I R E+ Sbjct 243 KSLRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEI 302 Query 305 LNLVNEEILQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +V +L++ G K L AGIVLTGG + + G+ A+++F VR GAP Sbjct 303 FGVV-------LGELQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQE 355 Query 364 ITGLTDYAQEPYYSTAVGLLHYG--KESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 + GL+D + P +STA+GLLH E +L + G + RL W+ F Sbjct 356 MGGLSDRVRTPRFSTAIGLLHAACKLEGNLPQPENGAVQEREGGGGLLARLKRWIENSF 414 >gi|7380686|emb|CAB85276.1| Gene info cell division protein [Neisseria meningitidis Z2491] gi|15794936|ref|NP_284758.1| Gene info cell division protein [Neisseria meningitidis Z2491] Length=414 Score = 466 bits (1201), Expect = 7e-130, Method: Composition-based stats. Identities = 174/422 (41%), Positives = 259/422 (61%), Gaps = 16/422 (3%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 ++ + L+IGT+KV AL+GEV D +NI+G+G PSRG+ G V ++++ V+ +++A Sbjct 3 QQQRYISVLDIGTSKVLALIGEVQDDDKINIVGLGQAPSRGLRAGMVTNIDATVQAIRQA 62 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 ++ AELMAD +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + Sbjct 63 VNDAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++L + Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +ERCGLK DQ Sbjct 123 QKILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIERCGLKSDQ 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LAS +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ Sbjct 183 IMLQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLS 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 + TP AE IK+ +G A G E +EVP VG R R + + LA +I R E+ Sbjct 243 KSLRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEI 302 Query 305 LNLVNEEILQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +V +L++ G K L AGIVLTGG + + G+ A+++F VR GAP Sbjct 303 FGVV-------LGELQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQE 355 Query 364 ITGLTDYAQEPYYSTAVGLLH-----YGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 + GL+D + P +STA+GLLH G L A E+ G + RL W+ Sbjct 356 MGGLSDRVRTPRFSTAIGLLHAACKLEGNLPQLENGAVQERE---GGGGLLARLKRWIEN 412 Query 419 EF 420 F Sbjct 413 SF 414 >gi|2738588|gb|AAC46068.1| cell division protein [Buchnera aphidicola] Length=418 Score = 465 bits (1199), Expect = 1e-129, Method: Composition-based stats. Identities = 240/420 (57%), Positives = 331/420 (78%), Gaps = 2/420 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MI + +RKLVVGLEIGT KV LVGEVL +G + IIG+G C S G+DKG +NDL++V+ C Sbjct 1 MIISKNRKLVVGLEIGTTKVVTLVGEVLTNGKIKIIGIGICQSNGIDKGRINDLDAVISC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 ++ +I QAE+MA+CQI+SVYL+LS K+I+C NEIG+VPISE+EVT+ED+ENV+HTAKSV+ Sbjct 61 IRESIHQAEIMANCQITSVYLSLSSKYINCPNEIGIVPISEDEVTKEDIENVIHTAKSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +EH +LHVIPQEY+ID Q GIKNP+GLSG RMQ +VHLITCH +MAKNI+KAVE+C + Sbjct 121 ILNEHHILHVIPQEYSIDQQSGIKNPIGLSGTRMQVRVHLITCHQNMAKNIIKAVEKCDI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ+IF+GLASS +VLTEDE +LGVC++DIGGGT+D+ Y G+++ ++VIPYAGN+VT Sbjct 181 KVDQVIFSGLASSKAVLTEDECKLGVCMIDIGGGTIDLITYIDGSIQDSQVIPYAGNIVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DI+YAF T SD+E IK+++G A+ G +++++ S G ++LQ+ T+ EVI+ R Sbjct 241 KDISYAFSTSYSDSEKIKIKYGSAIKLSPGTSKNIDLSSKYGNFQKNLQQDTVIEVIDSR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL+L+N IL +Q+KL ++G K+ L GIVLTGGA+ I L CA+++F ++RI Sbjct 301 YNELLHLINNRILYVQKKLYKEGRKYQLTGGIVLTGGASTISFLTECAEKIFQKKIRIAK 360 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 PLNI+GLTD EP+YST VGLLHYGKE + + +KR + + W +++++W +KEF Sbjct 361 PLNISGLTDNVTEPHYSTVVGLLHYGKEFYFDDT--NQKREISFIEKWFQKISNWFKKEF 418 >gi|83572614|gb|ABC19166.1| Gene info cell division protein FtsA [Moorella thermoacetica ATCC 39073] gi|83589700|ref|YP_429709.1| Gene info cell division protein FtsA [Moorella thermoacetica ATCC 39073] Length=410 Score = 465 bits (1198), Expect = 2e-129, Method: Composition-based stats. Identities = 166/419 (39%), Positives = 249/419 (59%), Gaps = 11/419 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 +V G++IGT KV A+V EV+P+G +NIIG+G PS G+ KG + D+E+ + + Sbjct 1 MPKDNIVAGIDIGTTKVVAVVAEVMPEGRLNIIGLGETPSGGLRKGIIVDIENTSRAIAG 60 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRV 121 AI+QAE M+ CQ+ S ++ L+G HI N G+V ++ E E++ EDVE V+ A+ + + Sbjct 61 AIEQAERMSGCQVHSAFVGLTGPHIDSLNNRGVVAVTGEDGEISLEDVERVLQAARVIPL 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 E R++HV+P++Y +D +G+ +PVG+ G R++ + ++T +NI+K+V+R GL Sbjct 121 AAERRIIHVLPRQYIVDGYDGVMDPVGMCGSRLEVETQIVTAAGAAVQNIMKSVQRAGLA 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 VD+L+ LAS+ +VL + ERELG VVDIGGGT +IA+ + G+L V+P +TS Sbjct 181 VDELVLNPLASAGAVLQQAERELGSVVVDIGGGTTEIALISQGSLWFASVLPIGSEHITS 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 D+A TP AE IK +GC V +E+VEVP VGGR R + R+ LA +IEPR Sbjct 241 DLAVGLRTPIVQAEVIKKEYGCVPADAVPDNEAVEVPPVGGREKRRVSRKALAAIIEPRV 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ LV E L + L G+VLTGG A +EG+ A + VR+G P Sbjct 301 EEIFTLVRRE-------LSSAHFQGLLPGGVVLTGGGALLEGITGMAAEILAMPVRLGWP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 +GL D P Y+TAVGL++YG + +A + ++ RL SW R+ F Sbjct 354 EGGSGLADMVAAPPYATAVGLVNYGARRLAHPQAAATRE--TGWENFWSRLKSWWRELF 410 >gi|59801865|ref|YP_208577.1| Gene info FtsA [Neisseria gonorrhoeae FA 1090] gi|59718760|gb|AAW90165.1| Gene info putative cell division protein [Neisseria gonorrhoeae FA 1090] Length=414 Score = 464 bits (1195), Expect = 4e-129, Method: Composition-based stats. Identities = 171/418 (40%), Positives = 256/418 (61%), Gaps = 10/418 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 ++ + L+IGT+KV AL+GEV D +NIIG+G PSRG+ G V ++++ V+ +++A Sbjct 3 QQKRYISVLDIGTSKVLALIGEVQDDDKINIIGLGQAPSRGLRAGMVTNIDATVQAIRQA 62 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 ++ AELMAD +I+ V ++G HI N G+V I + EVTQ D++ + TAK++ + + Sbjct 63 VNDAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPD 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++L + Q+Y ID Q G++ P+G+SGVR+ +VH+IT + +N+ K +E CGLK DQ Sbjct 123 QKILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIELCGLKSDQ 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LAS +VLTEDE++LGVCV+DIGGGT DIAVY GA+RHT VIP GN++T D++ Sbjct 183 IMLQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLS 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 + TP AE IK+ +G A G E +EVP VG R R + + LA +I R E+ Sbjct 243 KSLRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEI 302 Query 305 LNLVNEEILQLQEKLRQQGV-KHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +V +L++ G K L AGIVLTGG + + G+ A+++F VR GAP Sbjct 303 FGVV-------LGELQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQE 355 Query 364 ITGLTDYAQEPYYSTAVGLLHYG--KESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 + GL+D + P +STA+GLLH E +L + G + RL W+ Sbjct 356 MGGLSDRVRTPRFSTAIGLLHAACKLEGNLPQPENGTVQEREGGGGLLARLKRWIENN 413 >gi|53729115|ref|ZP_00134079.2| COG0849: Actin-like ATPase involved in cell division [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length=424 Score = 462 bits (1190), Expect = 1e-128, Method: Composition-based stats. Identities = 217/419 (51%), Positives = 301/419 (71%), Gaps = 5/419 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGL+IGT+KV A+VGEVLPDG++N+IG GSCP++G+D+GGV DL++ V Sbjct 1 MTKIAESKIIVGLDIGTSKVVAVVGEVLPDGVINVIGSGSCPAKGVDRGGVIDLDAAVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+QAE ++DCQI V LA+SG+HI+ NE G VP+S VT ED++ +H A+S++ Sbjct 61 IQRAIEQAESVSDCQIIGVTLAISGQHITALNESGTVPLSGT-VTNEDIDAAIHIARSIK 119 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D LH+IPQEY +D KNPVGLSG+R+QA+ H++ CH D +N+ AVER L Sbjct 120 LPDGLETLHIIPQEYKVDRLPATKNPVGLSGMRLQAQAHIVACHQDWLRNLKNAVERAKL 179 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQ++F+GLASSYSVLTEDE+ELGVC++DIGGGTMDI VYT GALR +KVIP+AGN VT Sbjct 180 KVDQVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTDGALRFSKVIPFAGNNVT 239 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 IA F T ++AE+IK+ +G A+ D+ +EV +GGR PR+ + +A V Sbjct 240 DYIAQVFTTSRNEAESIKINYGSAVNPPTHNADKKIEVAGLGGRMPRTFTKAQVATVTSQ 299 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 Y++LL +V E++QL+ +L Q+G+K L AG VLTGG +QIE + CA+ +F +QVR+G Sbjct 300 CYSDLLKVVENELVQLRHELLQKGIKQELIAGFVLTGGGSQIEDIVECAREIFGSQVRVG 359 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 PLNITGLTDY +P Y+T +GLL Y H N + + ++ V S + L+ L+K Sbjct 360 YPLNITGLTDYVNKPQYATVLGLLQYS---HYNSDEKGNGEISEKVDSILDILSRGLKK 415 >gi|75429980|ref|ZP_00732550.1| ATPases of the HSP70 class involved in cell division [Actinobacillus succinogenes 130Z] gi|74276763|gb|EAO50355.1| ATPases of the HSP70 class involved in cell division [Actinobacillus succinogenes 130Z] Length=430 Score = 458 bits (1180), Expect = 2e-127, Method: Composition-based stats. Identities = 213/430 (49%), Positives = 297/430 (69%), Gaps = 10/430 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K +VGLE+GT KV A+VGEVLPDG+VN++GVGS PS+G+DKG + DL +VV Sbjct 1 MAKIVESKTIVGLEVGTTKVVAVVGEVLPDGVVNVLGVGSSPSKGIDKGSITDLSAVVSS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+ AE +ADCQI SV LA++G+HI NE G VPI+ EVTQ+++++ +HTA SV+ Sbjct 61 IQRAIENAESVADCQIVSVTLAITGEHIQSFNESGFVPIANGEVTQDEIDSAMHTASSVK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D +LHVIPQE+A+D Q IK+P+GL GVR++A+ HLI C N+ KAVE CGL Sbjct 121 LPDGLSLLHVIPQEFAVDKQHNIKSPLGLQGVRLKAQAHLIGCQQAWLTNLQKAVESCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD ++F+GLAS+YSVLTEDE++LGVC++D GGG+MDI VYT GALR++KV+PY GN +T Sbjct 181 KVDDVVFSGLASTYSVLTEDEKDLGVCMIDFGGGSMDIMVYTNGALRYSKVVPYGGNDIT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDE-----SVEVPSVGGRPPRSLQRQTLAE 295 +A + T ++AE+IK+ +G AL E VEV +GG R+ + + + Sbjct 241 DFVAQSLTTSRNEAESIKINYGSALNPSQELVEHFAKTKVEVAGLGGTSSRTFTKAQIVD 300 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 V Y +LL +V E++ L+ L +G+KH L AG+VLTGG AQ+E +A CA +F Sbjct 301 VTSKCYGDLLKVVQNELINLRNDLTVKGIKHDLIAGVVLTGGGAQMEDVAKCATDIFGLH 360 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESH-----LNGEAEVEKRVTASVGSWIK 410 VR+G+PLNITGLTDY +P Y+T +GLL Y + + G E + S+ S IK Sbjct 361 VRVGSPLNITGLTDYVNKPQYATVLGLLQYTHHNDEETKPIFGSVNDEDSILGSIWSKIK 420 Query 411 RLNSWLRKEF 420 ++ + +R EF Sbjct 421 KIGNKVRSEF 430 >gi|33148197|gb|AAP95717.1| Gene info cell division protein FtsA [Haemophilus ducreyi 35000HP] gi|33151975|ref|NP_873328.1| Gene info cell division protein FtsA [Haemophilus ducreyi 35000HP] Length=426 Score = 456 bits (1176), Expect = 7e-127, Method: Composition-based stats. Identities = 207/429 (48%), Positives = 297/429 (69%), Gaps = 12/429 (2%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGL+IGT+K+A +VGEVLPDG++N++G +CPS+G+D+GGV DL++ V Sbjct 1 MTKIAESKIIVGLDIGTSKIAVVVGEVLPDGVINVLGASNCPSKGIDRGGVIDLDAAVNS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAI+QAE +++CQI V LA+SG+HI+ NE G++P+S V +ED++ +H A S++ Sbjct 61 IQRAIEQAESVSNCQIMGVTLAISGQHITALNESGVIPLSGTVVRKEDIDAAIHIAHSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D LH+I QEY +D KNP+GLSG+R++A+ H+I CH D +N+ A ER L Sbjct 121 LPDGLENLHIIAQEYNVDQLPATKNPIGLSGMRLRAQAHIIACHQDWLRNLKNAAERAKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVD ++F+GLASSYSVLTEDE+ELGVC++DIGGGTMDI VYT ALR +KVIPYAGN VT Sbjct 181 KVDTVVFSGLASSYSVLTEDEKELGVCLIDIGGGTMDILVYTDNALRFSKVIPYAGNNVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIV-GKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 IA F T S+AEAIK ++G A+ D+ +E+ +GGR PR+ + +A V Sbjct 241 DYIANVFTTSRSEAEAIKTKYGNAVSLPNHSPDQKIEIAGLGGRMPRTFTKADVATVTSK 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 Y +LL LV E+ +L+++L Q+G+K L AG VLTGG +QIE + CA+ +F +QVR+G Sbjct 301 CYNDLLTLVQVELTKLRDELFQKGIKQELIAGFVLTGGGSQIEDIVECAKNIFGSQVRVG 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS--------VGSWIKR 411 +PLNI+GLTDY +P Y+TA+GLL Y H N + E + + +K+ Sbjct 361 SPLNISGLTDYVNKPLYATALGLLQYS---HYNSQKESNNGEVGEKVDSLLDILSNSVKK 417 Query 412 LNSWLRKEF 420 + +W + F Sbjct 418 VVNWAKSSF 426 >gi|75234331|ref|ZP_00718709.1| COG0849: Actin-like ATPase involved in cell division [Escherichia coli E110019] Length=324 Score = 452 bits (1164), Expect = 2e-125, Method: Composition-based stats. Identities = 324/324 (100%), Positives = 324/324 (100%), Gaps = 0/324 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC Sbjct 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR Sbjct 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL Sbjct 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT Sbjct 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR Sbjct 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGV 324 YTELLNLVNEEILQLQEKLRQQGV Sbjct 301 YTELLNLVNEEILQLQEKLRQQGV 324 >gi|12720363|gb|AAK02230.1| Gene info FtsA [Pasteurella multocida subsp. multocida str. Pm70] gi|15602011|ref|NP_245083.1| Gene info FtsA [Pasteurella multocida subsp. multocida str. Pm70] Length=426 Score = 451 bits (1161), Expect = 4e-125, Method: Composition-based stats. Identities = 214/426 (50%), Positives = 292/426 (68%), Gaps = 6/426 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M K + K++VGLE+GT+KV ALVGE+LPDG+VNI+GVGSCP++G+DKG + DL +VV Sbjct 1 MAKIVESKIIVGLEVGTSKVVALVGELLPDGVVNILGVGSCPAKGIDKGNITDLNAVVTS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 VQRAI+ AE +ADC+I SV LA++G+HI N+ G PI++ EVTQED++ +HTA S++ Sbjct 61 VQRAIELAESVADCEIISVTLAITGQHIQSWNDSGAAPIADTEVTQEDIDAALHTASSIK 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + VLH +PQEYA+D Q+ IKNP+G G R+ + VHLI CH D N+ +AVERC L Sbjct 121 MPEGLVVLHRLPQEYAVDQQKNIKNPLGFQGGRLTSNVHLIACHQDWLNNLRQAVERCKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 K+D++IF+G+A+S+SVLTEDE++LGVC++D G GTM++ VYT GALR +KVIPYAGN VT Sbjct 181 KIDKVIFSGIATSHSVLTEDEKDLGVCLIDFGAGTMEVMVYTNGALRFSKVIPYAGNRVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCAL-GSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 DIAY T +AE IKV++G A+ +E +V S+ G + L+ V Sbjct 241 DDIAYDLTTSRVEAENIKVKYGSAVTPPRQNPEEQFDVMSIDGSVIERCSKTRLSNVTAG 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY E+L LV EE++QL+ L + +K L AGIV+TGG AQI+ L CA VF VRIG Sbjct 301 RYREILELVKEELIQLKYDLESKQMKFELIAGIVITGGGAQIKDLKECATDVFGLHVRIG 360 Query 360 APLNITGLTDYA-QEPYYSTAVGLLHY----GKESHLNGEAEVEKRVTASVGSWIKRLNS 414 PLNITG+T ++P YST +GLL Y ES +N E S+ S +K++ Sbjct 361 NPLNITGVTHLVEKKPQYSTVLGLLQYEYSSNDESPINDAYSNESGFFGSLWSGMKKIAK 420 Query 415 WLRKEF 420 + EF Sbjct 421 KVGSEF 426 >gi|39576781|emb|CAE80945.1| Gene info cell division protein FtsA [Bdellovibrio bacteriovorus HD100] gi|42524572|ref|NP_969952.1| Gene info cell division protein FtsA [Bdellovibrio bacteriovorus HD100] Length=418 Score = 448 bits (1154), Expect = 2e-124, Method: Composition-based stats. Identities = 161/423 (38%), Positives = 254/423 (60%), Gaps = 11/423 (2%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 ++ GL+IG+ KV+ ++G V P+G + + GVG+ P+ G+ +G V ++E+ + Sbjct 3 TSKPKAPVLAGLDIGSTKVSFVIGTVNPEGKIEVAGVGTAPNTGIRQGVVVNIEATTDSI 62 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121 ++A ++AELM+ +S V++ ++G HIS + GMV I EVT +++ V+ AK+V V Sbjct 63 RKAKEEAELMSGYTVSEVWVGVAGSHISSFDSKGMVAIKNREVTASEIDRVIEAAKAVAV 122 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + VLHV+P+E+ +D Q+GI +P+G+SG+R++A VH++T N VK VE+ GLK Sbjct 123 PTDRSVLHVLPREFKVDGQDGITDPIGMSGIRLEANVHIVTGGQSAINNTVKCVEKAGLK 182 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 + L+ + LAS+ +V++ DE+ LGVCVVD+GGG + + G++ H+ VIP G T Sbjct 183 IAGLVLSQLASATAVMSNDEKNLGVCVVDMGGGACNALYFVNGSVAHSSVIPVGGQHFTH 242 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 D+A TP AE +K +HGCA+ S+V ++E+VEV VGGR R + R+ LA+VIE R Sbjct 243 DVAVGLRTPQFAAEELKKKHGCAMASMVNENETVEVEGVGGRKSRVIPRKDLADVIEARA 302 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E LNL+ +I R G+ L GIVLTGGA+ ++GL + +F VR GAP Sbjct 303 EETLNLIANDI-------RMSGLMPMLGGGIVLTGGASNLDGLIEMGEFIFDIPVRRGAP 355 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLN----GEAEVEKRVTASVGSWIKRLNSWLR 417 I GLTD + +S AVGLL Y + + + E + S+ K++ + Sbjct 356 REIGGLTDVVKSGEFSAAVGLLQYALGQRKDLLQTHQQQQEVNIGESLDGITKKIKEFFG 415 Query 418 KEF 420 + F Sbjct 416 QIF 418 >gi|27904093|gb|AAO26927.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Bp (Baizongia pistaciae)] gi|38372214|sp|Q89AQ4|FTSA_BUCBP Cell division protein ftsA gi|27904696|ref|NP_777822.1| Gene info cell division protein FtsA [Buchnera aphidicola str. Bp (Baizongia pistaciae)] Length=421 Score = 447 bits (1152), Expect = 4e-124, Method: Composition-based stats. Identities = 226/424 (53%), Positives = 309/424 (72%), Gaps = 7/424 (1%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 MIK +KL+VGLEIGT K VGE+L D +NIIG+G S G+D+G +NDL+S+V+C Sbjct 1 MIKVLKKKLIVGLEIGTTKTTISVGEILEDDTINIIGIGLSKSIGIDRGIINDLKSIVEC 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +++ I+QAE MA+C I+S+YLALS K+I+CQNEIG++PI +EE+T+ D+ENV+HTAKSVR Sbjct 61 IKKVINQAETMANCNITSIYLALSNKYINCQNEIGIIPILQEEITKNDIENVIHTAKSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 +R+EH++LH+IPQEY+ID + GIKNP+GLSG+RMQA VHLITCH+ + KNI+KAVE CG+ Sbjct 121 IRNEHKILHIIPQEYSIDERTGIKNPIGLSGIRMQAIVHLITCHSSIKKNIIKAVESCGI 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +VD +F+GLASS SVLT DER LGVC+VDIGGGT DIA+YT G L+H+ VIPYAGN VT Sbjct 181 RVDYSVFSGLASSESVLTTDERNLGVCIVDIGGGTTDIAIYTNGTLKHSCVIPYAGNTVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 +DI+Y F P AE IK+++G A+ S +E +++ + ++ + L EVIE R Sbjct 241 NDISYVFNIPFMYAEKIKIKYGYAMQSSDITEEEIKIVNEDNTIIQTFHKDKLTEVIESR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 Y ELL L+NEEI Q+KL++ G H L AGIVLTGGA+ I+ CA++VF+ VRIG Sbjct 301 YIELLTLINEEIKNTQKKLKKSGRIHKLGAGIVLTGGASNIKLFKNCAEKVFNIPVRIGC 360 Query 361 P----LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWL 416 P +N LT+ Q ST +GLL++GK+ + K W++ +N+W+ Sbjct 361 PKKNNINTAKLTNNTQTGSLSTVIGLLYFGKKYFYSHR---NKNSYNFFKKWLQYINNWI 417 Query 417 RKEF 420 +KEF Sbjct 418 KKEF 421 >gi|46156643|ref|ZP_00132283.2| COG0849: Actin-like ATPase involved in cell division [Haemophilus somnus 2336] Length=424 Score = 445 bits (1147), Expect = 1e-123, Method: Composition-based stats. Identities = 225/424 (53%), Positives = 302/424 (71%), Gaps = 4/424 (0%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + + K+ VGLE+GT+KV A+VGE+LPDG+VN++G GSCPS+G+DKG + DL +VV Sbjct 1 MARIVEDKIFVGLEVGTSKVVAVVGELLPDGVVNVLGAGSCPSKGIDKGSITDLNAVVTS 60 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120 +QRAID E +AD QI SV LA++G+HI NE G VPI+EEEVTQE+VE +HTA SVR Sbjct 61 IQRAIDSTEAVADSQIFSVTLAITGEHIQSLNENGFVPIAEEEVTQEEVEAALHTASSVR 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + D +LH+IPQE+A+D Q IK+P+GL GVR+ A+ HLI CH D N+ KAVERC L Sbjct 121 IGDGLALLHIIPQEFAVDKQVNIKDPLGLQGVRLSAQAHLIACHQDWLNNLKKAVERCKL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 KV++++++G ASS +VLTEDE+ELGVC++D G GTMDI VYT G +R +KVIPYAGN VT Sbjct 181 KVNKVVYSGYASSQAVLTEDEKELGVCLIDFGAGTMDIVVYTNGFIRFSKVIPYAGNRVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGK-DESVEVPSVGGRPPRSLQRQTLAEVIEP 299 DIAYA T ++AE+IKV +G A+ + D+ +EV S+GGR PR + ++ L+ + Sbjct 241 DDIAYACATSRTEAESIKVAYGSAVSPPLDPLDKKIEVASIGGRAPRVISKEQLSIITSA 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 RY ELL +V E+ QL+ +L + +K L AGIV+TGG AQIEGL CA +VF +QVRIG Sbjct 301 RYAELLGVVKSELDQLKYQLENKQIKFELIAGIVITGGGAQIEGLRECATQVFGSQVRIG 360 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWI---KRLNSWL 416 PLNITGLTDY +P YST VGLLH+ + +E + + K++ + + Sbjct 361 VPLNITGLTDYVNKPQYSTVVGLLHHHNNDFEDILSESDTETDGVGKKFWNICKKVVNKV 420 Query 417 RKEF 420 R EF Sbjct 421 RSEF 424 >gi|20136385|gb|AAM11651.1| cell division protein FtsA [Azospirillum brasilense] Length=420 Score = 443 bits (1142), Expect = 6e-123, Method: Composition-based stats. Identities = 137/420 (32%), Positives = 215/420 (51%), Gaps = 14/420 (3%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 +AT ++ L++G+ KV L+ V G V I+G+G + G+ G + D+E+ + Sbjct 11 RATRGGIIAALDVGSTKVCCLIARVEDAGGVRIVGIGHQIATGVRAGAIIDMEAAETSIG 70 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVR 122 A+ AE MA+ I V + +S VP+S +EVT+ DV + A+S++V Sbjct 71 AAVHAAEQMANETIRDVIVNVS--SPISHGFNAEVPVSGQEVTESDVRRALAHARSLQVG 128 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + ++H IP +A+D GI++P G+ G R+ + H+IT +N+ V RC L + Sbjct 129 PDQALVHAIPVGFALDGSRGIRDPKGMYGERLGVQAHVITSPAGAVRNLQTCVARCHLDI 188 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 + L+ + AS + L +DE E+G +D+GGGT I+V++ G L + I GN VT+D Sbjct 189 EGLVASPYASGLACLVDDEMEMGSACIDMGGGTTTISVFSEGTLVWSDCIRLGGNHVTND 248 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAEVIEP 299 IA TP AE +K HG A+ S + E ++VP VG +L + L +I+P Sbjct 249 IARGLTTPVVHAERMKTLHGSAINSPADEREMIDVPQVGEEERLGANNLPKSYLVRIIQP 308 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R E+ V + +L G + +VLTGGA+Q+ G+ AQ + QVRIG Sbjct 309 RLEEIFEHV-------RSRLEHSGYAKLVGRRVVLTGGASQLPGMRELAQLILDKQVRIG 361 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ITGL + P YSTA GLL + + E V + + R+ WLR+ Sbjct 362 RPTRITGLNEAQGGPSYSTAAGLLLHAVRN--PAELPVAGHEAGAGTGFFGRVGLWLREN 419 >gi|89210851|ref|ZP_01189235.1| Cell division protein FtsA [Halothermothrix orenii H 168] gi|89159592|gb|EAR79256.1| Cell division protein FtsA [Halothermothrix orenii H 168] Length=390 Score = 440 bits (1133), Expect = 7e-122, Method: Composition-based stats. Identities = 158/394 (40%), Positives = 240/394 (60%), Gaps = 21/394 (5%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 R+++ GL+IGT K+ A++ EV + ++IIG+G PS G+ KG V D++ +++A++ Sbjct 4 RRIITGLDIGTTKICAMIAEVNSEDKLDIIGIGLSPSHGLRKGIVVDIDKTSNAIKQAVE 63 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDE 124 +AE MA QI S ++ ++G HIS N G+V +S EE + D++ V+ AK + + E Sbjct 64 KAERMAGRQIDSAFVGIAGSHISSLNSHGVVAVSGEEKEIKPSDIQRVMEAAKIIPLSAE 123 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++HV+ +E+ +D GIK+P+G+SGVR++ + H++T +N+VK+V R GL VD Sbjct 124 EEIIHVLAREFIVDGCPGIKDPLGMSGVRLEVETHIVTGSTTSIQNLVKSVLRAGLDVDD 183 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 ++ LASS SVLTEDE+ELGV +VD+GGGT D+ V+ G++ +T V+P GN V++DIA Sbjct 184 IVLEPLASSESVLTEDEKELGVALVDVGGGTTDLIVFQEGSITYTSVLPVGGNHVSNDIA 243 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 TP ++AE IK+ G A +G DE +EV S + + R+ L EVIEPR E+ Sbjct 244 VGLRTPIAEAEKIKIMAGSATTKNIGDDEYIEVVSASRKKKNKIPRKALCEVIEPRMQEI 303 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 NLV E+ ++ G + AG+VLTGGA+ +EG A V VR+G P + Sbjct 304 FNLVKRELDEV-------GPRDLTPAGVVLTGGASLLEGAEELASEVIGLPVRLGEPDYV 356 Query 365 TGLTDYAQEP------------YYSTAVGLLHYG 386 GLTD P +STAVGL+ YG Sbjct 357 NGLTDVIDNPVYVKKGKQVPKAIFSTAVGLVEYG 390 >gi|88999609|emb|CAJ75587.1| FTSA protein [Geobacillus thermoleovorans] Length=443 Score = 435 bits (1120), Expect = 2e-120, Method: Composition-based stats. Identities = 133/436 (30%), Positives = 229/436 (52%), Gaps = 32/436 (7%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQ 62 K + ++VV L++GT+ V ++GE+L +NIIGVG+ + G+ KG + D++ V+ ++ Sbjct 21 KMSSNEIVVSLDVGTSSVKVIIGEML-GSSINIIGVGNVKAEGLKKGAIVDIDKTVQSIR 79 Query 63 RAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVR 120 RA++QAE M I V + ++G HI + G+V + E++ EDV V+ A+ V Sbjct 80 RAVEQAERMVGLSIRRVIVGVAGSHIQLHDCHGIVAVASENREISDEDVARVIDAAQVVS 139 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + + ++ V+P+++ +D +GI +P G+ GVR++ + ++T + N+++ VER GL Sbjct 140 IPPDREIIGVVPRQFIVDGLDGIHDPRGMLGVRLEMEGTMVTGAKTVLHNLLRCVERAGL 199 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++ + LA+ VL++DER LG +VD+GGG+ +AV+ G L+ +P G +T Sbjct 200 EISDICLQPLAAGSLVLSDDERHLGAALVDLGGGSTTVAVFEQGTLQAVSSLPVGGEHIT 259 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 D+A T DAE IK++HG A ++E VP +G + + +A++IE R Sbjct 260 KDLAIGLRTTTDDAEKIKLKHGHAFYDYASEEEVFSVPIMGTDQHQQFSQLEIADIIEAR 319 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+L +V +E+ R+ G + L G VLTGG A + GL A V T VRI Sbjct 320 LEEILQMVQQEV-------RRLGFRD-LPGGYVLTGGVANMPGLLELAHVVLGTSVRIAM 371 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRVTASVGS------------ 407 P I ++P Y+ VGLL + +++ L G+ V Sbjct 372 PDYIG-----VRDPQYTIGVGLLKFAYRQAQLQGKTVPVAAAVEPVERSSPKQQSKPKKK 426 Query 408 ---WIKRLNSWLRKEF 420 + K++ + F Sbjct 427 EDHFGKKVKRFFGSFF 442 >gi|83575195|gb|ABC21746.1| Gene info Cell division protein FtsA [Rhodospirillum rubrum ATCC 11170] gi|83592281|ref|YP_426033.1| Gene info Cell division protein FtsA [Rhodospirillum rubrum ATCC 11170] Length=440 Score = 434 bits (1118), Expect = 3e-120, Method: Composition-based stats. Identities = 132/419 (31%), Positives = 204/419 (48%), Gaps = 10/419 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 L+ L++GT K+A + DG + ++GVG SRGM G V +++ V V+ A Sbjct 29 QRGGLITALDVGTTKIACFIAREEEDGALRVLGVGHHRSRGMRNGQVANMDEVELSVRAA 88 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDE 124 +D AE MA+ +ISSV + +SG + I+ EV DV + + + + Sbjct 89 VDAAEQMANERISSVVVNVSGGQPHSTRVEVEMSIAGHEVRGNDVRRIQAYGRGLHTSAD 148 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++H IP YAID EG+ +P G+ G + +HL++ +N+ VERC L ++ Sbjct 149 RELVHCIPVSYAIDGTEGVLDPRGMFGQSLGVSIHLVSAAAGPLRNLSTVVERCHLDIED 208 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + + AS + L EDE+++GV V+D+GGGT IAV+ G + HT++IP G VT+DIA Sbjct 209 KVVSPYASGLACLVEDEKQMGVTVIDLGGGTTSIAVFHEGHVVHTEMIPVGGLHVTNDIA 268 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPP---RSLQRQTLAEVIEPRY 301 TP ++AE +K HG S E + VP VG + R L ++I PR Sbjct 269 KGLTTPVANAERLKTIHGSCSVSPADTREILRVPLVGEDDEATANEVPRSMLVQIIRPRI 328 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E LV + +L G +VLTGG +Q++G+ A+ + QVR G P Sbjct 329 EETFELV-------RGRLEASGFDKVGGRLVVLTGGGSQLQGVRELAEVILDRQVRPGRP 381 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 I GL D P ++T G+L Y + + + R W + F Sbjct 382 QRIRGLADSTSGPAFATCAGMLRYAVQHQVETPDTDPTADETVATGALGRFARWWKDNF 440 >gi|10175179|dbj|BAB06278.1| Gene info cell-division protein (septum formation) [Bacillus halodurans C-125] gi|15615122|ref|NP_243425.1| Gene info cell-division protein (septum formation) [Bacillus halodurans C-125] Length=425 Score = 432 bits (1114), Expect = 1e-119, Method: Composition-based stats. Identities = 135/433 (31%), Positives = 228/433 (52%), Gaps = 35/433 (8%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + ++ V L+IGT+ V ++GE+ DG +NIIGVG+ PS G+ KG + D++ V+ ++RA+ Sbjct 3 NNEIYVSLDIGTSNVRIIIGEIT-DGSINIIGVGNAPSEGIKKGSIVDIDETVRSIRRAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRD 123 +QAE M I V + ++G H+ Q G+V +S + E+ ED+ V+ A+ V + Sbjct 62 EQAERMVGLSIRQVIVGVNGNHVQLQPCHGVVAVSSPDREIGDEDIARVIDAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P G+ GVR++ + +IT + N+++ VER GL+V Sbjct 122 EREIIDVIPKQFIVDGLDEINDPRGMIGVRLEMEGTIITGSKTLLHNLLRCVERAGLEVA 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ +++DE+ LGVC++DIGGG+M I+ + G+L T VIP G+ VT+DI Sbjct 182 DICLQALAAGSVAISKDEKSLGVCLIDIGGGSMTISCFEQGSLVDTSVIPVGGDHVTNDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 A +A IK HG A +++ EV ++G P + + LA +IEPR E Sbjct 242 AVGLRISTEEAIKIKHTHGHAYIDEASEEDRFEVKAIGSTEPEAFSQFELAHIIEPRMEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + L+N E+ +L + H G VLTGG+ + G+ A+ VR+ P Sbjct 302 MFELINRELRRLGQ--------HDFPGGFVLTGGSVMMPGVLELAKETLGRNVRVAIPDY 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKE-------------------SHLNGEAEVEKRVTAS 404 I +EP Y+T VGL+ + + + E E+ T Sbjct 354 IG-----VREPQYTTGVGLIQFAYKNVKIQGKEVAAAVAEAGVEQEQRPKKEKERSRTNE 408 Query 405 VGSWIKRLNSWLR 417 ++ +W + Sbjct 409 GPGVKSKVKNWFK 421 >gi|6458332|gb|AAF10210.1| Gene info cell division protein FtsA [Deinococcus radiodurans R1] gi|15805657|ref|NP_294353.1| Gene info cell division protein FtsA [Deinococcus radiodurans R1] Length=517 Score = 432 bits (1113), Expect = 1e-119, Method: Composition-based stats. Identities = 132/382 (34%), Positives = 218/382 (57%), Gaps = 8/382 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + ++VGL+IGT K+ ++GEV PDG ++IIG GS PS GM +G V +LE + +++++ Sbjct 3 ENSIIVGLDIGTTKITTVIGEVAPDGTIDIIGEGSVPSEGMKRGSVINLERATQAIKQSL 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS-EEEVTQEDVENVVHTAKSVRVRDE 124 AE ++ + +V++++ G H G+ I ++E++ DVE + A++V + Sbjct 63 HAAERVSGVRAWNVFVSVGGNHTKAMTSHGLAAIRRQQEISPPDVERAIENARAVPLDPS 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 +LH IPQEY +D QEGIKNPVG+ GVR++ VH++ N+ + V+ GL+++ Sbjct 123 LEILHTIPQEYVVDGQEGIKNPVGMHGVRLEVDVHIVAGSAGPLLNLRRCVQEAGLQIEG 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LAS + L E+ VVD+GGGT DI V+ G L H+ IP G+ VT+D+A Sbjct 183 FVLHSLASGLATLDHSEQNQTTVVVDMGGGTTDIGVFKRGNLAHSASIPIGGDHVTADLA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 P +AE +K +G A+ + ++ ++E+ + G ++ L+ VI PR +E+ Sbjct 243 QILKIPMEEAEKVKRHYGAAIPELADQELTLEITTASG-ATHAISAYELSRVIRPRVSEI 301 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L+ +EI Q G +A +VLTGG AQ+ G A+ F R+G P I Sbjct 302 YGLIRDEIDQ------ALGPVELVAQSVVLTGGGAQLPGAVDLARERFRLPTRLGRPRGI 355 Query 365 TGLTDYAQEPYYSTAVGLLHYG 386 GL+D +P ++ +VG++ YG Sbjct 356 HGLSDIVGDPAHACSVGMVLYG 377 >gi|46201828|ref|ZP_00054266.2| COG0849: Actin-like ATPase involved in cell division [Magnetospirillum magnetotacticum MS-1] Length=404 Score = 431 bits (1111), Expect = 2e-119, Method: Composition-based stats. Identities = 135/410 (32%), Positives = 205/410 (50%), Gaps = 10/410 (2%) Query 14 EIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMAD 73 ++GT KV + ++ DG ++G+G +RGM G V D+E + ++ A++ AE MA+ Sbjct 2 DVGTTKVCCFIAKIQDDGSPRMVGIGHQVARGMRNGAVVDMEELETSIRAAVESAEEMAN 61 Query 74 CQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQ 133 Q+ +V + +SG H N V ++ V + D+ ++ ++ + ++H IP Sbjct 62 DQVRAVAVNISGGHPGSANVKVEVAMNGHAVNEADIRRMLEHGRAHHESPDRELIHAIPV 121 Query 134 EYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASS 193 +Y ID EGIK+P G+ G R+ +H+I +N+ V RC L ++ + + AS Sbjct 122 DYTIDGNEGIKDPRGMFGDRLGVAIHVIAAGIGPVRNLCTVVNRCHLDIEARVVSPYASG 181 Query 194 YSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSD 253 + L EDE+ELGV +D+GGGT IAV+ GG L HT VI G VTSDIA TP Sbjct 182 LACLVEDEKELGVTCIDMGGGTTSIAVFLGGQLVHTDVIAVGGAYVTSDIARGLSTPVIH 241 Query 254 AEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAEVIEPRYTELLNLVNE 310 AE +K +G + S E +VP VG +QR L ++I+PR E LV Sbjct 242 AERLKTLYGSVIPSANDDREIFKVPLVGEDEDGASNQVQRSMLIQIIQPRLEETFELV-- 299 Query 311 EILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDY 370 + L Q G +VLTGGA+Q++G A V QVR+G P+ + GL + Sbjct 300 -----RSHLEQGGFDKLAGRRVVLTGGASQMQGARDLAGHVLDKQVRLGKPIGLHGLPEA 354 Query 371 AQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P +ST GL+ Y + RL SWL++ F Sbjct 355 TGGPAFSTCAGLIRYALAHAPAQSRGKRTGKSGEGQGGWGRLGSWLKRNF 404 >gi|15075191|emb|CAC46748.1| Gene info CELL DIVISION PROTEIN [Sinorhizobium meliloti] gi|3122114|sp|O30994|FTSA_RHIME Cell division protein ftsA gi|2465468|gb|AAC45823.1| cell division protein [Sinorhizobium meliloti] gi|15965922|ref|NP_386275.1| Gene info CELL DIVISION PROTEIN [Sinorhizobium meliloti 1021] Length=442 Score = 430 bits (1108), Expect = 4e-119, Method: Composition-based stats. Identities = 130/426 (30%), Positives = 216/426 (50%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IG+ KV ++G + P + +IG+G SRG+ G + DL++V Sbjct 24 VVSVLDIGSTKVVCMIGRLTPRAESQILPGRTHSIEVIGIGHQKSRGVKNGVIADLDAVE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 V+ A+D AE MA I S+ + +S + + + +EV D++ V+ A Sbjct 84 SVVRLAVDAAERMAGLTIDSLIVNVSAGRLQSDVYTATIDLGGQEVEANDLKKVLAAAGH 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R + +LH +P +++D + GI++P+ + G + +H++T KN+ V R Sbjct 144 QSLRTDRAILHSLPTGFSLDGERGIRDPLAMFGDVLGVDMHVLTAERPALKNLELCVNRA 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ ++ AS + L +DE ELG +D+GGGT I+V+ G L H + G+ Sbjct 204 HLSVEGMVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGKLVHADAVGLGGHH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 VT+D+A T DAE +KV HG AL + + + + VP +G P + R ++ Sbjct 264 VTTDLARGLSTRIEDAERLKVVHGSALPNSADERDIISVPPIGEDDRDQPTHVPRALVSR 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E L L+ + I ++ G + IVLTGGA+Q+ GL A+R+ Sbjct 324 IVRARIEETLELIRDRI-------QRSGFSPIVGKRIVLTGGASQLTGLPEAARRILARN 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTA-SVGSWIKRLNS 414 VRIG PL ++GL A+ P +STAVGL+ Y + + L A + S R+ Sbjct 377 VRIGRPLGVSGLPAAAKGPAFSTAVGLMIYPQVADLETHAAGSGMFSTLGGNSRFARMGQ 436 Query 415 WLRKEF 420 WL++ F Sbjct 437 WLKESF 442 >gi|89099617|ref|ZP_01172492.1| cell division protein (septum formation) [Bacillus sp. NRRL B-14911] gi|89085770|gb|EAR64896.1| cell division protein (septum formation) [Bacillus sp. NRRL B-14911] Length=426 Score = 429 bits (1106), Expect = 7e-119, Method: Composition-based stats. Identities = 136/408 (33%), Positives = 227/408 (55%), Gaps = 17/408 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V +++AI+ Sbjct 4 NEIYVSLDIGTSSVKVIIGEMVND-SLNIIGVGNVKSEGLRKGSIVDIDETVHSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M +I V + ++G H+ Q G+V +S E+T EDV V+ A+ V + E Sbjct 63 QAERMIGMEIRQVIVGITGNHVMLQPSHGVVAVSSDNREITDEDVARVIDAAQVVSIPPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++ VIP+++ +D I +P G+ GVR++ + +IT + NI++ VER GL++ Sbjct 123 REIVDVIPKQFIVDGLNEINDPRGMIGVRLEMEGTIITGSKTILHNILRCVERAGLEILD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA+ L++DE LGV +VD+GGG+ +A++ G ++ T V+P G+ +T D++ Sbjct 183 ITLQPLAAGAFALSKDEMNLGVALVDMGGGSTTVALFEQGIMKATIVLPVGGDHITKDLS 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T DAE IK ++G A +DE VP +G + + ++++IE R E+ Sbjct 243 IGLRTSTEDAEKIKTKYGYAFYDHASEDEVFSVPIIGSDQHQQFNQLEISDIIEARMEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 +L+ EI +L GV L G VLTGG A +G+ AQ +F +VRI P I Sbjct 303 FDLIQNEIKRL-------GVSD-LPGGYVLTGGVANTQGILELAQIIFQNRVRIAIPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRVTASVGSWIKR 411 +EP Y+TAVGL+ + K + L G +V + +++ Sbjct 355 G-----VREPQYTTAVGLIKFAYKNARLQGRKIEPAQVNEAKEKRVQK 397 >gi|56379501|dbj|BAD75409.1| Gene info cell division protein (septum formation) [Geobacillus kaustophilus HTA426] gi|56419659|ref|YP_146977.1| Gene info cell division protein (septum formation) [Geobacillus kaustophilus HTA426] Length=422 Score = 429 bits (1106), Expect = 9e-119, Method: Composition-based stats. Identities = 132/435 (30%), Positives = 228/435 (52%), Gaps = 32/435 (7%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 + ++VV L++GT+ V ++GE+L +NIIGVG+ + G+ KG + D++ V+ ++R Sbjct 1 MSSNEIVVSLDVGTSSVKVIIGEML-GSSINIIGVGNVKAEGLKKGAIVDIDKTVQSIRR 59 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVRV 121 A++QAE M I V + ++G HI + G+V + E++ EDV V+ A+ V + Sbjct 60 AVEQAERMVGLSIRRVIVGVAGSHIQLHDCHGIVAVASENREISDEDVARVIDAAQVVSI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + ++ V+P+++ +D +GI +P G+ GVR++ + ++T + N+++ VER GL+ Sbjct 120 PPDREIIGVVPRQFIVDGLDGIHDPRGMLGVRLEMEGTMVTGAKTVLHNLLRCVERAGLE 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 + + LA+ VL++DER LG +VD+GGG+ +AV+ G L+ +P G +T Sbjct 180 ISDICLQPLAAGSLVLSDDERHLGAALVDLGGGSTTVAVFEQGTLQAVSSLPVGGEHITK 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 D+A T DAE IK++HG A ++E VP +G + + +A++IE R Sbjct 240 DLAIGLRTTTDDAEKIKLKHGHAFYDYASEEEVFSVPIMGTDQHQQFSQLEIADIIEARL 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+L +V +E+ R+ G + L G VLTGG A + GL A V T VRI P Sbjct 300 EEILQMVQQEV-------RRLGFRD-LPGGYVLTGGVANMPGLLELAHVVLGTSVRIAMP 351 Query 362 LNITGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRVTASVGS------------- 407 I ++P Y+ VGLL + +++ L G+ V Sbjct 352 DYIG-----VRDPQYTIGVGLLKFAYRQAQLQGKTVPVAAAVEPVERSSPKQQSKPKKKE 406 Query 408 --WIKRLNSWLRKEF 420 + K++ + F Sbjct 407 DHFGKKVKRFFGSFF 421 >gi|82947793|dbj|BAE52657.1| Gene info Actin-like ATPase involved in cell division [Magnetospirillum magneticum AMB-1] gi|83312952|ref|YP_423216.1| Gene info Actin-like ATPase involved in cell division [Magnetospirillum magneticum AMB-1] Length=414 Score = 428 bits (1102), Expect = 3e-118, Method: Composition-based stats. Identities = 139/420 (33%), Positives = 210/420 (50%), Gaps = 10/420 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 A L+ L++GT KV + ++ DG ++G+G +RGM G V D+E + ++ Sbjct 2 AARNGLIAALDVGTTKVCCFIAKIQDDGSPRMVGIGHQVARGMRNGTVVDMEELETSIRA 61 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A++ AE MA+ Q+ +V + +SG H N V ++ V + D+ ++ ++ Sbjct 62 AVEAAEEMANDQVRAVAINISGGHPGSANVKVEVAMNGHAVNEADIRRMLEHGRAHHESP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + ++H IP +Y ID EGIK+P G+ G R+ +H+I +N+ V RC L ++ Sbjct 122 DRELIHAIPVDYTIDGNEGIKDPRGMFGDRLGVAIHVIAAGIGPVRNLSTVVNRCHLDIE 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + + AS + L EDE+ELGV +D+GGGT IAV+ GG L HT VI G VTSDI Sbjct 182 ARVVSPYASGLACLVEDEKELGVTCIDMGGGTTSIAVFLGGQLVHTDVIAVGGAHVTSDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAEVIEPR 300 A TP AE +K +G + S E +VP VG +QR L ++I+PR Sbjct 242 ARGLSTPVVHAERLKTLYGSVIPSASDDREIFKVPLVGEDEDGASNQVQRSMLIQIIQPR 301 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E LV + L Q G +VLTGGA+Q++G A +V QVR+G Sbjct 302 LEETFELV-------RSHLEQSGFDKLAGRRVVLTGGASQMQGARDLAGQVLDKQVRLGK 354 Query 361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P+ + GL + P +ST GL+ Y S RL SWL++ F Sbjct 355 PIGLHGLPEATGGPAFSTCAGLIRYALVHAPAPSRGKRTGAGGDGASGWGRLGSWLKRNF 414 >gi|23348273|gb|AAN30339.1| Gene info cell division protein FtsA [Brucella suis 1330] gi|17982505|gb|AAL51765.1| Gene info CELL DIVISION PROTEIN FTSA [Brucella melitensis 16M] gi|62290319|ref|YP_222112.1| Gene info FtsA, cell division protein FtsA [Brucella abortus biovar 1 str. 9-941] gi|62196451|gb|AAX74751.1| Gene info FtsA, cell division protein FtsA [Brucella abortus biovar 1 str. 9-941] gi|17986867|ref|NP_539501.1| Gene info CELL DIVISION PROTEIN FTSA [Brucella melitensis 16M] gi|23502297|ref|NP_698424.1| Gene info cell division protein FtsA [Brucella suis 1330] Length=440 Score = 424 bits (1091), Expect = 5e-117, Method: Composition-based stats. Identities = 126/428 (29%), Positives = 214/428 (50%), Gaps = 22/428 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESV 57 +L+ L++G++KV+ ++ + P + ++G+G SRG+ G + DL++ Sbjct 20 RLLTVLDVGSSKVSCVIARLRPHEGGALLPGRTHRMEVLGIGHQRSRGVKSGVIIDLDAA 79 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + S+ + +S + + V + EV Q D+ V+ Sbjct 80 EQSIRLAVDAAERMAGLTVDSLIVNISAGRLKSETFTASVNLGGHEVEQTDIRRVLAAGA 139 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 + E ++H +P Y +D + GI+ P+G+ G + +H++T +N+ + R Sbjct 140 KQALAAERHLVHSLPVGYTLDGERGIREPLGMLGDSLGVDMHVLTADAAPLRNLELCINR 199 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 C L V+ ++ AS + L DE E+G +D+GGGT I+V++ G H + GN Sbjct 200 CHLSVEAIVATPYASGLAALVGDEAEMGAACIDMGGGTTTISVFSEGKFIHADAVAIGGN 259 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLA 294 VT D+A F T DAE +KV +G AL S + + VP +G P R L Sbjct 260 HVTMDVARGFSTRMEDAERLKVMYGSALPSAADDRDLISVPPIGDDERDVPNQYPRSVLT 319 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E L LV +++L Q G+ H + +VLTGGA+Q+ G+ A+R+ Sbjct 320 RIIRARVEETLELV-------RDRLNQSGLGHIVGKRVVLTGGASQLPGMPEAARRILAR 372 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAE--VEKRVTASVGSWIKRL 412 VRIG PL I GL + A+ ++ VGLL Y + + + + + G I+R+ Sbjct 373 NVRIGRPLGIAGLPEAAKGAAFAATVGLLIYPQVAGIEERSVKAASSGLMTGTGGRIQRV 432 Query 413 NSWLRKEF 420 WLR+ F Sbjct 433 GQWLRESF 440 >gi|82700243|ref|YP_414817.1| Gene info Heat shock protein Hsp70:Cell division protein FtsA [Brucella melitensis biovar Abortus 2308] gi|82616344|emb|CAJ11401.1| Gene info Heat shock protein Hsp70:Cell division protein FtsA [Brucella melitensis biovar Abortus] Length=440 Score = 422 bits (1088), Expect = 1e-116, Method: Composition-based stats. Identities = 127/428 (29%), Positives = 214/428 (50%), Gaps = 22/428 (5%) Query 8 KLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESV 57 +L+ L++G++KV+ ++ + P + ++G+G SRG+ G + DL++ Sbjct 20 RLLTVLDVGSSKVSCVIARLRPHEGGALLPGRTHRMEVLGIGHQRSRGVKSGVIIDLDAA 79 Query 58 VKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAK 117 + ++ A+D AE MA + S+ + +S + + V + EV Q D+ V+ Sbjct 80 EQSIRLAVDAAERMAGLTVDSLIVNISAGRLKSETFTASVNLGGHEVEQTDIRRVLAAGA 139 Query 118 SVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVER 177 + E ++H +P Y +D + GI+ P+G+ G + +H++T +N+ + R Sbjct 140 KQALAAERHLVHSLPVGYTLDGERGIREPLGMLGDSLGVDMHVLTADAAPLRNLELCINR 199 Query 178 CGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGN 237 C L V+ ++ AS + L DE E+G +D+GGGT I+V++ G H + GN Sbjct 200 CHLSVEAIVATPYASGLAALVGDEAEMGAACIDMGGGTTTISVFSEGKFIHADAVAIGGN 259 Query 238 VVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLA 294 VT D+A F T DAE +KV +G AL S + + VP +G P R L Sbjct 260 HVTMDVARGFSTRMEDAERLKVMYGSALPSAADDRDLISVPPIGDDERDVPNQYPRSVLT 319 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E L LV +++L Q G+ H + +VLTGGA+QI G+ A+R+ Sbjct 320 RIIRARVEETLELV-------RDRLNQSGLGHIVGKRVVLTGGASQIPGMPEAARRILAR 372 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAE--VEKRVTASVGSWIKRL 412 VRIG PL I GL + A+ ++ VGLL Y + + + + + G I+R+ Sbjct 373 NVRIGRPLGIAGLPEAAKGAAFAATVGLLIYPQVAGIEERSVKAASSGLMTGTGGRIQRV 432 Query 413 NSWLRKEF 420 WLR+ F Sbjct 433 GQWLRESF 440 >gi|50877783|emb|CAG37623.1| Gene info probable cell division protein FtsA [Desulfotalea psychrophila LSv54] gi|51246746|ref|YP_066630.1| Gene info cell division protein FtsA [Desulfotalea psychrophila LSv54] Length=447 Score = 422 bits (1088), Expect = 1e-116, Method: Composition-based stats. Identities = 154/407 (37%), Positives = 251/407 (61%), Gaps = 11/407 (2%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 ++V+GL+IGT K+ +VGE+L D + I+GVG+ PS G+ KG V ++ES V+ +Q+A+ Sbjct 49 EIVIGLDIGTTKICCVVGELLDDSLY-ILGVGTVPSSGLKKGVVYNIESTVQSIQKALRL 107 Query 68 AELMADCQISSV--YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEH 125 AE +D ++ +V Y+ ++G HI N G+V I++ E+ + D+E V A++V++ Sbjct 108 AEESSDYELKNVPAYVGIAGDHIKGFNSPGIVAINDREIKKSDLEAVRRAAQTVKISQNQ 167 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 ++HV+PQEY +D GI+NPVG++GVR+ VH++T N+V E+ G+KV L Sbjct 168 NIIHVLPQEYMVDDNVGIQNPVGMTGVRLATNVHIVTADVGAIHNLVTCCEKAGVKVASL 227 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + +AS+++VLT +E+E GV +VDIGGGT D AV+ GG +R T I + G+ +T+DI+ Sbjct 228 VLESVASAHAVLTREEKENGVALVDIGGGTTDTAVFHGGTVRQTSQINFGGHNLTNDISV 287 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 T DAE +K +G A+ S+V + VEVP G + P ++ L E++E R E+L Sbjct 288 GLLTSLGDAEWLKENYGGAIASVVKSNYVVEVPKRGDKNPVKTPQKFLVEILEARTKEIL 347 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNIT 365 +V+E +++ G K ++ GIVLTGG A + +A A+++F VR+G P +T Sbjct 348 EMVDEALIE-------SGQKTNIGHGIVLTGGTALLPNIADLAEQIFDLPVRVGYPEGLT 400 Query 366 GLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRL 412 G + P +TAVGL+ +G+E H G+ V+ V + + K + Sbjct 401 GRVENVYTPRCTTAVGLVLFGREEH-QGKGLVDHSVFTKICRFFKNI 446 >gi|25527251|gb|AAN04560.1| FtsA [Bacillus mycoides] Length=433 Score = 422 bits (1088), Expect = 1e-116, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 218/398 (54%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ L+ DER GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVALSSDERNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ +L K G VLTGG A + G+ A + H VRI P I Sbjct 303 LMFVQDEVHKLGVKQAASGY--------VLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|47779267|gb|AAT38535.1| FtsA [Bartonella bacilliformis] gi|83751530|ref|ZP_00947943.1| COG0849: Actin-like ATPase involved in cell division [Bartonella bacilliformis KC583] Length=432 Score = 422 bits (1086), Expect = 2e-116, Method: Composition-based stats. Identities = 122/428 (28%), Positives = 205/428 (47%), Gaps = 20/428 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLE 55 + + L++G++K+ L+ + P + I+G G S G+ G + D+ Sbjct 12 KTRFLTVLDVGSSKIVCLIACLHPLEHARHLYGRTHSIEILGFGMQRSCGIKSGVIMDMV 71 Query 56 SVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHT 115 + + ++ A+D AE MA + SV + S + G V + EVT DV + Sbjct 72 AAERSIRLAVDAAEKMAGLVVDSVIVNFSSSCLKSSFINGTVCLDGHEVTPYDVRMALAD 131 Query 116 AKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAV 175 EH ++H +P YA+D +GI +P+G+ G + VH++T +N+ + Sbjct 132 VSRKAFDAEHHIVHTVPAFYALDGNKGIVDPIGMIGKTLGVNVHVVTAETAPLRNLETCI 191 Query 176 ERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYA 235 R L V+ ++ AS SVL DE LG +D+GGGT ++V++ G HT V+P Sbjct 192 NRAHLSVEAMVATPFASGLSVLINDEARLGAACIDLGGGTTTLSVFSEGKFVHTDVLPVG 251 Query 236 GNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG-GRPPRSLQRQTLA 294 G+ VT D+A F +AE +K+ +G + V +G G R L Sbjct 252 GHHVTLDVARGFSMSIEEAERLKIVYGSTFSMSADDRCMINVLEIGNGHHETEYPRAVLG 311 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+L + ++++L + G H + ++LTGGA+Q+ GL A+ + Sbjct 312 RIIRARVEEILEM-------MRDRLNRSGFGHIIGKRVILTGGASQLTGLPEMARNILGR 364 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVE--KRVTASVGSWIKRL 412 VRIG PL I+ L +A+ +S+AVGLL Y + + K ++ G + +R+ Sbjct 365 NVRIGRPLGISRLPSFAKGATFSSAVGLLIYPQLVGFEKKTVQTAVKYLSTGRGKYFQRV 424 Query 413 NSWLRKEF 420 WLRK F Sbjct 425 GQWLRKTF 432 >gi|89203119|ref|ZP_01181816.1| Cell division protein FtsA [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|89148876|gb|EAR69420.1| Cell division protein FtsA [Bacillus cereus subsp. cytotoxis NVH 391-98] Length=434 Score = 421 bits (1085), Expect = 2e-116, Method: Composition-based stats. Identities = 132/395 (33%), Positives = 222/395 (56%), Gaps = 17/395 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-TLNIIGVGNVKSNGLKKGSIVDIDETVQSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ L+ DE+ GV +VDIGGG+ +A++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVALSSDEKNRGVALVDIGGGSTTLAIFRDGELQATSVLPIGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +AE IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENAEQIKLKYGHAFYDTASEEEVFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L LV EE+ R+ GVK +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 LMLVQEEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRITTPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVE 398 +EP Y+ VGL+ Y +++ L G++ E Sbjct 355 G-----VREPQYTIGVGLIKYSYQKAKLRGKSVQE 384 >gi|68193729|gb|EAN08381.1| Cell division protein FtsA [Mesorhizobium sp. BNC1] gi|69275289|ref|ZP_00611201.1| Cell division protein FtsA [Mesorhizobium sp. BNC1] Length=437 Score = 421 bits (1084), Expect = 3e-116, Method: Composition-based stats. Identities = 119/434 (27%), Positives = 210/434 (48%), Gaps = 24/434 (5%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPD----------GMVNIIGVGSCPSRGMDKGGVND 53 A ++ L++G++KV+ ++ ++LPD + ++G+G S+G+ G V D Sbjct 11 AQRSGIITVLDVGSSKVSCIIAKLLPDENMRALPHRTHRIRVVGIGHQKSQGVKSGVVVD 70 Query 54 LESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVV 113 L+ + ++ A+D AE MA + S+ + +S I + + + EV D+ V+ Sbjct 71 LDRAEQAIRLAVDAAERMAGLTVDSLIVNVSAGRIRSETASATINLGGHEVANADIARVL 130 Query 114 HTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVK 173 +R E V+H + +++D + GI++P G+ G + +H++T +N+ Sbjct 131 LAGARQALRAEREVVHSLAVGFSLDVERGIRDPRGMMGDALGVDMHVVTADAVPLRNLEL 190 Query 174 AVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIP 233 + R L V++++ AS + L +DE E+G +D+GGGT ++V+ G H IP Sbjct 191 CINRAHLSVERMVATPYASGLAALVDDEAEMGAACIDMGGGTTTMSVFVDGKFVHADAIP 250 Query 234 YAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALG-SIVGKDESVEVPSVGGRP---PRSLQ 289 GN VT D+A SDAE +KV G AL + E V + +GG P + Sbjct 251 VGGNHVTMDLARGLSIRLSDAERLKVMQGSALPVTTSDDREMVSIQPIGGDEMDQPLQVP 310 Query 290 RQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQ 349 R + ++ R E L LV +++L + G + +VLTGGA+Q+ GL A+ Sbjct 311 RSVMTRIVRARVEETLELV-------RDRLNRSGYGALVGRRVVLTGGASQLSGLPEAAR 363 Query 350 RVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRV---TASVG 406 R+ VR+G PL + GL + A+ ++ VGLL Y + + A + + Sbjct 364 RLLGRNVRLGRPLGVAGLPEAAKGAAFAAPVGLLIYPQVAEFESRAAAKGGLFMRATGTA 423 Query 407 SWIKRLNSWLRKEF 420 +R+ W R F Sbjct 424 GRFQRVGQWFRDSF 437 >gi|14022286|dbj|BAB48896.1| Gene info cell division protein; FtsA [Mesorhizobium loti MAFF303099] gi|13471544|ref|NP_103110.1| Gene info cell division protein FtsA [Mesorhizobium loti MAFF303099] Length=435 Score = 420 bits (1083), Expect = 4e-116, Method: Composition-based stats. Identities = 118/429 (27%), Positives = 210/429 (48%), Gaps = 21/429 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPD----------GMVNIIGVGSCPSRGMDKGGVNDLE 55 + L++G+ KV +V ++ P+ + +IG+G S+G+ G V DL+ Sbjct 14 RSGTLTVLDVGSNKVCCMVAKLKPNDDGKLLRGRSHRIQVIGIGHQKSQGVKSGVVVDLD 73 Query 56 SVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHT 115 ++ ++D AE MA + S+ + ++ + + + + E + D++ V+ Sbjct 74 RAEHAIRLSVDAAERMAGLTVDSLIVNMTAGRLKSEAFSATINLGGHEADEADIKRVLGA 133 Query 116 AKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAV 175 ++ E V+H +P +++D + G+++P G+ G + +H++T +N+ ++ Sbjct 134 GAKQALKAEREVIHSLPVGFSLDAERGVRDPRGMVGDALGVDMHVLTGDAAPMRNLELSI 193 Query 176 ERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYA 235 R L V++++ AS + L +DE ELG +D+GGGT I+V++ G H I Sbjct 194 NRSHLSVERMVATPYASGLAALVDDELELGAACIDMGGGTTTISVFSEGKFVHGDAIAIG 253 Query 236 GNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG--GRPPRSLQRQTL 293 GN VT D+A T AE +KV HG AL + V + +G G P + R + Sbjct 254 GNHVTLDMAKGLSTSLDAAERLKVMHGSALPGSADDRDLVSIQPIGDDGDVPLQIPRSVM 313 Query 294 AEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFH 353 ++ R E L L L+++L + G + + +VLTGGA+Q+ GL A+R+ Sbjct 314 TRIVRARIDETLEL-------LRDRLNKSGYGNAVGKRVVLTGGASQLAGLPEAARRILG 366 Query 354 TQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAE--VEKRVTASVGSWIKR 411 VRIG PL + GL + A+ P +S AVGLL Y + + + G + R Sbjct 367 RNVRIGRPLGVAGLPEAAKGPAFSAAVGLLIYPQMASFESHPAKGISGLRMTGTGGKLHR 426 Query 412 LNSWLRKEF 420 ++ WLR F Sbjct 427 MSQWLRDSF 435 >gi|83816584|ref|YP_444706.1| Gene info cell division protein FtsA [Salinibacter ruber DSM 13855] gi|83757978|gb|ABC46091.1| Gene info cell division protein FtsA [Salinibacter ruber DSM 13855] Length=425 Score = 420 bits (1082), Expect = 5e-116, Method: Composition-based stats. Identities = 157/424 (37%), Positives = 245/424 (57%), Gaps = 14/424 (3%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 A + +VVG++IGT KV A+V VNI+GVG PS G+++G V +++ V V+ Sbjct 6 AMNENIVVGVDIGTTKVCAVVAGKDDLDRVNILGVGMAPSDGLNRGVVVNIDRTVAAVRE 65 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRD 123 A+++AE A ++ +V + ++G H+ G+V I+ E+TQ DV+ ++ V + Sbjct 66 AVEEAERAAGVEVQNVVVGIAGDHVQSFQTRGVVTINANEITQNDVQRLLEDTTHVALPA 125 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 + +LHVIPQE+ +D Q+G+ +PVG+SGVR++A VH+IT AKNI + +E+ G +V Sbjct 126 DREILHVIPQEFIVDGQDGVADPVGMSGVRLEADVHIITGLVSAAKNIYRCIEKAGFRVS 185 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 L+ LASS+SVL EDE+E+GV ++DIGGGT DIAV+ +RHT VI AG+ VT DI Sbjct 186 DLVLEPLASSFSVLHEDEKEVGVALIDIGGGTTDIAVFEDHTIRHTAVIAVAGDKVTDDI 245 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 G AE +K + G AL DE +E+P +GGR +++ R LA++I+PR E Sbjct 246 RKGLGVMRDQAEQLKRQFGVALAGEADSDEKIEIPGIGGRDEKTIGRDALAQIIQPRLEE 305 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L + EI ++ G HL G VLTGG + + A V + R+G P+ Sbjct 306 ILEIAAMEI-------KRSGYGRHLGVGAVLTGGGSLVPYTDELAAEVLGMEARVGRPMG 358 Query 364 I-TGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVT------ASVGSWIKRLNSWL 416 + GL + +P +ST VGL+ YG + G + + V A + + R+ + + Sbjct 359 LSGGLVEEVSDPKFSTGVGLVLYGMRPDIIGGTTLSEEVRAHQNGQAGGETLMARIANRM 418 Query 417 RKEF 420 + F Sbjct 419 KAWF 422 >gi|75762941|ref|ZP_00742744.1| Cell division protein ftsA [Bacillus thuringiensis serovar israelensis ATCC 35646] gi|74489570|gb|EAO52983.1| Cell division protein ftsA [Bacillus thuringiensis serovar israelensis ATCC 35646] Length=435 Score = 419 bits (1080), Expect = 9e-116, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 223/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ R+ GVK +A+G VLTGG A + G+ A + H VR+ P I Sbjct 303 LMFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRVATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|47504487|gb|AAT33163.1| Gene info cell division protein FtsA [Bacillus anthracis str. 'Ames Ancestor'] gi|49180684|gb|AAT56060.1| Gene info cell division protein FtsA [Bacillus anthracis str. Sterne] gi|49186757|ref|YP_030009.1| Gene info cell division protein FtsA [Bacillus anthracis str. Sterne] gi|30258553|gb|AAP27772.1| Gene info cell division protein FtsA [Bacillus anthracis str. Ames] gi|47529339|ref|YP_020688.1| Gene info cell division protein ftsa [Bacillus anthracis str. 'Ames Ancestor'] gi|30263909|ref|NP_846286.1| Gene info cell division protein FtsA [Bacillus anthracis str. Ames] gi|65321234|ref|ZP_00394193.1| COG0849: Actin-like ATPase involved in cell division [Bacillus anthracis str. A2012] Length=433 Score = 419 bits (1079), Expect = 1e-115, Method: Composition-based stats. Identities = 126/398 (31%), Positives = 223/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 LMFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|56910362|dbj|BAD64889.1| Gene info cell division initiation protein FtsA [Bacillus clausii KSM-K16] gi|56964119|ref|YP_175850.1| Gene info cell division initiation protein FtsA [Bacillus clausii KSM-K16] Length=430 Score = 419 bits (1079), Expect = 1e-115, Method: Composition-based stats. Identities = 134/443 (30%), Positives = 226/443 (51%), Gaps = 41/443 (9%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 V L+IGT+ V +V EV +G +NI+GVG+ PS G+ KG + D++ VK ++RA Sbjct 1 MSSDTYVSLDIGTSSVRVIVAEV-ANGSINILGVGNVPSEGIKKGTIVDIDETVKSIERA 59 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVR 122 +DQAE M I V + ++G H+ G+V +S + E+ EDV V+ A+ V + Sbjct 60 VDQAERMVGITIKHVVVGVNGSHVELLPCHGVVAVSSSDREIGVEDVRRVMDAAQVVSIP 119 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 E ++ VIP+++ +D + I +P G+ GVR++ + +IT + N+++ VER GL+V Sbjct 120 PEREIIDVIPKQFIVDGLDEITDPKGMIGVRLEMEGTMITGAKTVLHNLLRCVERAGLEV 179 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 ++ GLA+ +++DE+ LGVCV+DIGGG+ I+V+ G L T V+P G+ +T+D Sbjct 180 AEICLNGLATGTVAVSKDEKSLGVCVIDIGGGSTTISVFEQGTLAATSVLPIGGDHITND 239 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYT 302 +A +AE IK ++G A DE + +VG L + LA +IEPR Sbjct 240 LAVGLRLTTEEAERIKCKYGHAFIEEASSDEQFAIQTVGSNEKEMLTQLDLAHIIEPRVE 299 Query 303 ELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPL 362 E+L L +E+++L + H +G VLTGG + G+ + + VR+ P Sbjct 300 EILELSAKELVRLGFR--------HFPSGFVLTGGTVMLPGVLELTKDMLQGNVRVAIPN 351 Query 363 NITGLTDYAQEPYYSTAVGLLHYGKES-HLNGEAEV------------------------ 397 I +EP Y+ ++GL+ + ++ + G+ Sbjct 352 YIG-----VREPKYTVSIGLIQFAHKNGRVQGKEVAAAFSQASEAETADSSENHQPLRTT 406 Query 398 EKRVTASVGSWIKRLNSWLRKEF 420 E+ ++ SW + F Sbjct 407 EREPKRQEAKRESKMKSWFKTFF 429 >gi|49239955|emb|CAF26360.1| Gene info Cell division protein ftsA [Bartonella quintana str. Toulouse] gi|49474451|ref|YP_032493.1| Gene info Cell division protein ftsA [Bartonella quintana str. Toulouse] Length=432 Score = 419 bits (1079), Expect = 1e-115, Method: Composition-based stats. Identities = 120/428 (28%), Positives = 202/428 (47%), Gaps = 20/428 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLE 55 + + L++G++K+ L+ + P + I+G G SRG+ G V D+ Sbjct 12 KTRFLTVLDVGSSKIVCLIACLRPLKHIHYLHGRTHSMEILGFGVQRSRGIKSGVVMDMF 71 Query 56 SVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHT 115 + + ++ A+D AE MA + SV + S + GMV ++ EVT+ DV + Sbjct 72 AAEQSIRLAVDAAEKMAGLVVDSVIVNFSSSRLRSAFINGMVRLNGREVTKRDVRMALAD 131 Query 116 AKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAV 175 E VLH +P Y +D +GI +P+G++G VH++T +N+ + Sbjct 132 VSHKAFDAERHVLHSVPVSYVLDGDKGISDPIGMTGELFGVDVHVVTAETASLRNLEACI 191 Query 176 ERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYA 235 R L V+ ++ AS +VL DE LG +D GGGT +V++ G H + Sbjct 192 NRAHLSVEAMVVTPFASGLAVLMNDEAHLGAACIDFGGGTTTFSVFSEGKFVHADALAVG 251 Query 236 GNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP-PRSLQRQTLA 294 G VT D+A F ++AE +KV +G AL + + + V +G +P R L Sbjct 252 GYHVTLDVARGFSMSITEAERLKVVYGSALLTSADERHMINVTEIGNKPGEIQYPRAVLG 311 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+L +V ++ L + G H + ++LTGGA+Q+ GL A+ + Sbjct 312 RIIRARVEEILEMV-------RDCLNRSGFGHIIGKRVILTGGASQLTGLPEMARTILGR 364 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVE--KRVTASVGSWIKRL 412 VRIG PL I+ L A+ +++AVGLL Y + + ++ + + + Sbjct 365 NVRIGRPLGISRLPSLAKGAAFTSAVGLLIYPQLMGFEEKTVQAAVNHLSTGTRGYFQCV 424 Query 413 NSWLRKEF 420 WLR+ F Sbjct 425 GQWLRESF 432 >gi|17740547|gb|AAL43078.1| Gene info cell division protein [Agrobacterium tumefaciens str. C58] gi|15157219|gb|AAK87837.1| Gene info AGR_C_3785p [Agrobacterium tumefaciens str. C58] gi|2465464|gb|AAC45820.1| cell division protein [Agrobacterium tumefaciens] gi|61224300|sp|P0A332|FTSA_AGRTU Cell division protein ftsA gi|61224298|sp|P0A331|FTSA_AGRT5 Gene info Cell division protein ftsA gi|17935972|ref|NP_532762.1| Gene info cell division protein [Agrobacterium tumefaciens str. C58] gi|15889371|ref|NP_355052.1| Gene info hypothetical protein AGR_C_3785 [Agrobacterium tumefaciens str. C58] Length=443 Score = 419 bits (1079), Expect = 1e-115, Method: Composition-based stats. Identities = 126/427 (29%), Positives = 214/427 (50%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IG+ KV ++G + P V IIG+G SRG+ G + DL+++ Sbjct 24 IVSVLDIGSTKVVCMIGRLTPRQESEILPGRTHKVEIIGIGHQRSRGVKSGVIADLDALE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 ++ ++D AE MA + S+ + +S ++ + + +EV D+ V+ A Sbjct 84 GVIRLSVDAAERMAGLTVDSLIVNVSAGRLASDIYTASIDLGGQEVEASDLRKVLVAASQ 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R + +LH +P Y++D + GI++P+ + G + +H++T KN+ V R Sbjct 144 QSMRQDRAILHSLPTGYSLDGERGIRDPLSMYGDLLGVDMHVVTVERTALKNLELCVNRA 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ ++ AS + L +DE ELG +D+GGGT I+V+ G L HT I G+ Sbjct 204 HLSVEGMVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGRLIHTDAIGLGGHH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 VT+D+A T DAE +KV HG AL + + + + +P +G P + R + Sbjct 264 VTTDLARGLSTRIEDAERLKVVHGSALLNGADERDMISIPPIGEDDRDQPSQVSRALVTR 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E L L+ + I ++ G + +VLTGGA+Q+ GL A+R+ Sbjct 324 IVRARIEETLELIRDRI-------QKSGFSPIVGKRVVLTGGASQLTGLPETARRILARN 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK--RVTASVGSWIKRLN 413 VRIG P+ + GL A+ P +STA GL+ Y + + + A + I R+ Sbjct 377 VRIGRPMGVAGLPVAAKGPAFSTACGLMIYPQVADIEIHAAQGGMFSPFGNGSGRIARVG 436 Query 414 SWLRKEF 420 WL++ F Sbjct 437 QWLKESF 443 >gi|22777155|dbj|BAC13428.1| Gene info cell-division protein (septum formation) [Oceanobacillus iheyensis HTE831] gi|23098927|ref|NP_692393.1| Gene info cell-division protein [Oceanobacillus iheyensis HTE831] Length=428 Score = 418 bits (1077), Expect = 2e-115, Method: Composition-based stats. Identities = 123/386 (31%), Positives = 207/386 (53%), Gaps = 16/386 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +++V L+IGT + ++GEV D +NIIGVG+ S GM KG + D++ V ++ A+ Sbjct 3 NSEVLVSLDIGTTMIKVIIGEVQSD-SLNIIGVGTAKSNGMKKGAIVDIDQTVHSIRNAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVRVRD 123 +QAE M I V + ++G HI Q G+V + E+ EDV V+ A+ + + Sbjct 62 EQAERMVGMHIERVVVGINGSHIQLQPCHGVVAVQSENREIGDEDVTRVIDGAQVISIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P G+ GVR++ + +ITC + NI+K VER L+V Sbjct 122 EREIIDVIPRQFIVDGLDEITDPRGMIGVRLEMEGTIITCSKTVLHNILKCVERANLEVS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE +G ++DIGGG ++V+ L T VI G+ +T D+ Sbjct 182 DICLQPLAAGTIALSKDEMNMGAALIDIGGGCTTVSVFENDHLVATSVISLGGDNITKDL 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE IK+ +G A +DE+ EV ++G + + +A++IE R E Sbjct 242 SIGLRTSTEEAEDIKMNYGHAFYDDAQEDETFEVSTIGSNQRQVFNQLQIADMIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EI R+ G L G VLTGG + G AQ +F++ VR+ P Sbjct 302 IYAYVEREI-------RKMGY-RELPGGYVLTGGTIAMPGSLELAQDLFYSNVRVAIPDY 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKES 389 I +EP +++ +G+L + + Sbjct 354 IG-----VREPQFTSGIGILQFAYRN 374 >gi|29897552|gb|AAP10828.1| Gene info Cell division protein ftsA [Bacillus cereus ATCC 14579] gi|30021996|ref|NP_833627.1| Gene info Cell division protein ftsA [Bacillus cereus ATCC 14579] Length=435 Score = 417 bits (1074), Expect = 4e-115, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 223/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ R+ GVK +A+G VLTGG A + G+ A + H VR+ P I Sbjct 303 LMFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRVATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|42783000|ref|NP_980247.1| Gene info cell division protein FtsA [Bacillus cereus ATCC 10987] gi|47557059|gb|EAL15388.1| cell division protein FtsA [Bacillus cereus G9241] gi|47565779|ref|ZP_00236818.1| cell division protein FtsA [Bacillus cereus G9241] gi|42738927|gb|AAS42855.1| Gene info cell division protein FtsA [Bacillus cereus ATCC 10987] Length=435 Score = 417 bits (1074), Expect = 4e-115, Method: Composition-based stats. Identities = 126/398 (31%), Positives = 223/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ R+ GVK +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 LMFVQDEV-------RKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|34482388|emb|CAE09389.1| Gene info CELL DIVISION PROTEIN FTSA [Wolinella succinogenes] gi|34556674|ref|NP_906489.1| Gene info CELL DIVISION PROTEIN FTSA [Wolinella succinogenes DSM 1740] Length=467 Score = 415 bits (1070), Expect = 1e-114, Method: Composition-based stats. Identities = 123/405 (30%), Positives = 229/405 (56%), Gaps = 11/405 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + ++G++IG+ K+ ++ ++ DG+ ++IG G S+G+ KG + ++E + ++ AI+ Sbjct 2 NQTILGIDIGSTKICTIIADI-KDGVPHVIGTGIHKSQGLKKGAITNIELASRAIKSAIN 60 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTA-KSVRVRDEH 125 A+ +A S +++SG + N G+V I E+ +++ V+ TA + + +E+ Sbjct 61 DAKRVAGTNFSKAIVSISGVYTKSINSSGIVNIPNSEIGIKEINRVMQTALYNATIPNEY 120 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 VLHV+P + +D Q+ I +P+G+SG R++ VH++T N+ KAV+ G++++ + Sbjct 121 EVLHVLPYNFKVDDQDFIDDPLGMSGNRLEVFVHIVTAQRSSLGNLKKAVKAAGVEIENI 180 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + + AS+ +VL +DE+ELGV +D+GG T D+ V+ G ++++ + N +T+D++ Sbjct 181 VLSAYASAIAVLNDDEKELGVACIDMGGSTCDLMVHAGNSIKYNDFLGVGSNHITNDLSM 240 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPP-RSLQRQTLAEVIEPRYTEL 304 A TP S AE +KV +G + +E+P +G + + + VI R E Sbjct 241 ALRTPLSAAERVKVEYGSLNKHQDSGGDLIELPIIGDETSTHQVSLEVVHNVIYARVEE- 299 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVF-HTQVRIGAPLN 363 ++ L + L + +K HL AG+VLTGG +++G+ A +F H VRI PL Sbjct 300 ------TLMILAKSLEKSMLKEHLGAGVVLTGGMVKLDGIRELAGAIFSHMPVRIARPLE 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSW 408 I GL + ++P Y+TA+GL+ YG N E + EK++ + Sbjct 354 IDGLFENLRDPSYATAIGLILYGAGRFTNYEIDSEKKIRFKTEKF 398 >gi|49330000|gb|AAT60646.1| Gene info cell division protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49478444|ref|YP_037969.1| Gene info cell division protein [Bacillus thuringiensis serovar konkukian str. 97-27] Length=435 Score = 415 bits (1069), Expect = 1e-114, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 225/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L + +Q+++R+ GVK +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 L-------MFVQDEVRKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|2633899|emb|CAB13401.1| Gene info cell-division protein [Bacillus subtilis subsp. subtilis str. 168] gi|120567|sp|P28264|FTSA_BACSU Cell division protein ftsA gi|16078592|ref|NP_389411.1| Gene info cell-division protein [Bacillus subtilis subsp. subtilis str. 168] gi|142940|gb|AAA22456.1| ftsA Length=440 Score = 415 bits (1069), Expect = 1e-114, Method: Composition-based stats. Identities = 133/393 (33%), Positives = 219/393 (55%), Gaps = 17/393 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L++GT+ +VGE+ D +NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDLGTSNTKVIVGEMTGD-SLNIIGVGNVPSEGLKKGSIVDIDETVHSIRKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRD 123 DQAE M + + ++G +I+ Q+ G+V +S +E+ EDV V+ A+ V V Sbjct 62 DQAERMVGFPLRKAIVGVNGNYINIQDTNGVVAVSSENKEIQVEDVRRVMAAAQVVSVPH 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D ++ I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPKQFIVDGRDEITDPKKMLGVRLEVEGTLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ + L++DE+ LGV ++DIGGG+ IAV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSAALSKDEKNLGVALIDIGGGSTTIAVFQNGHLTSTRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A +DE EV +G ++ +Q A +IE R E Sbjct 242 SIGLRTSTEEAERVKKQLGHAYYDEASEDEIFEVTVIGTNQKQTFTQQEAANIIEARVEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 +L +V+EE LR G+ L G VLTGG A + G+ + AQ V VR+ P Sbjct 302 ILEIVSEE-------LRSMGITD-LPGGFVLTGGQAAMPGVMSLAQDVLQNNVRVQGPNY 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYG-KESHLNGEA 395 I ++P Y T VGL+ + + + + G Sbjct 354 IG-----VRDPQYMTGVGLIQFACRNARIQGRK 381 >gi|51975050|gb|AAU16600.1| Gene info cell division protein [Bacillus cereus E33L] gi|52141581|ref|YP_085248.1| Gene info cell division protein [Bacillus cereus E33L] Length=435 Score = 415 bits (1069), Expect = 2e-114, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 225/398 (56%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VD+GGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDMGGGSTTLSIFKDGELQATSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L + +Q+++R+ GVK +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 L-------MFIQDEVRKLGVK-QVASGYVLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y++ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTSGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|25527233|gb|AAN04556.1| FtsA [Bacillus mycoides] Length=433 Score = 415 bits (1068), Expect = 2e-114, Method: Composition-based stats. Identities = 125/398 (31%), Positives = 220/398 (55%), Gaps = 17/398 (4%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 ++ V L+IGT+ V ++GE++ D +NIIGVG+ S G+ KG + D++ V+ +++AI+ Sbjct 4 NEIYVSLDIGTSNVKVIIGEMVND-SLNIIGVGNVKSNGLKKGSIVDIDETVRSIKKAIE 62 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDE 124 QAE M I V + ++ + G+V +S + E+ EDV V+ A+ V + E Sbjct 63 QAERMVGIHIEQVVVGVNANQVQLLPCHGVVAVSNEDREIGNEDVLRVLDAAQVVSIAPE 122 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 + V+P+++ +D + I +P G+ GVR++ + LIT + N+++ VE+ GL++ Sbjct 123 REFIDVVPRQFIVDGLDEINDPRGMIGVRLEMEGTLITGSRTLLHNLLRCVEKAGLEIVD 182 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LA++ ++ DE+ GV +VDIGGG+ ++++ G L+ T V+P G+ +T DIA Sbjct 183 ICLQPLAAATVAISSDEKNRGVALVDIGGGSTTLSIFKDGELQTTSVLPLGGDHITKDIA 242 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 T +A+ IK+++G A ++E VP +G + L+++IE R E+ Sbjct 243 IGLKTSTENADQIKLKYGHAFYDTASEEEMFTVPIMGSDQTEQYSQLELSDIIEARVEEI 302 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNI 364 L V +E+ +L K +A+G VLTGG A + G+ A + H VRI P I Sbjct 303 LMFVQDEVHKLGIK--------QVASGYVLTGGIASMPGVLDLAYDILHENVRIATPDYI 354 Query 365 TGLTDYAQEPYYSTAVGLLHYG-KESHLNGEAEVEKRV 401 +EP Y+ VGL+ + +++ L G+ EK+ Sbjct 355 G-----VREPQYTIGVGLIKHSYQKAKLRGKNVQEKQE 387 >gi|86137672|ref|ZP_01056249.1| cell division protein FtsA [Roseobacter sp. MED193] gi|85826007|gb|EAQ46205.1| cell division protein FtsA [Roseobacter sp. MED193] Length=444 Score = 415 bits (1068), Expect = 2e-114, Method: Composition-based stats. Identities = 116/436 (26%), Positives = 209/436 (47%), Gaps = 26/436 (5%) Query 3 KATDRKLVVGLEIGTAKVAALV------GEVLPDGMV---------NIIGVGSCPSRGMD 47 +A R +V L+IG++K+A LV G + D + +IG + SRG+ Sbjct 17 QAMQRGVVAILDIGSSKIACLVLRFDGSGRLSEDNSIGSLAGQSGFRVIGAATTRSRGVQ 76 Query 48 KGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE 107 G + ++ + ++ A+ A+ MA ++ V + SG + + + +EV++ Sbjct 77 FGEITAMQETERAIRTAVQAAQKMAGVRVDHVIASFSGANPRSYGLDARLELDGQEVSET 136 Query 108 DVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDM 167 ++ V+ + + VLH P +A+D + G+ +P G G + +H++T Sbjct 137 EIAQVLAACEVPEYGSDREVLHAQPVNFALDNRSGLADPRGQLGQTLAVDMHMLTVDTGT 196 Query 168 AKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALR 227 +N+V+ ++RC L++ + + AS Y+ L EDE+ELG +D+GGG+ I+V+ + Sbjct 197 VQNLVRCIQRCDLELAGIASSAYASGYAALVEDEQELGAACIDMGGGSTSISVFMKKHMI 256 Query 228 HTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---P 284 + + G+ +TSDI+ G P ++AE IK G + V + +++ G Sbjct 257 YADAVRMGGDHITSDISMGLGVPMANAERIKTFCGGVHATGVDDRDMIDIGGDTGDWEHD 316 Query 285 PRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGL 344 R++ R L ++ PR E+L V + +L G ++ + IVLTGG++QI GL Sbjct 317 RRTVSRAELIGIMRPRVEEILEEV-------RTRLDAAGFEYLPSQQIVLTGGSSQILGL 369 Query 345 AACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 A R+ QVR+G PL + GL A P +++AVGL + + E V Sbjct 370 DGLATRILGQQVRLGRPLRVHGLPQSATGPGFASAVGLCLFAAHPQDEW-WDFETPVDRY 428 Query 405 VGSWIKRLNSWLRKEF 420 + R W R + Sbjct 429 PARSLSRAVRWFRDNW 444 >gi|69298116|ref|ZP_00620396.1| Cell division protein FtsA [Silicibacter sp. TM1040] gi|69134463|gb|EAN57678.1| Cell division protein FtsA [Silicibacter sp. TM1040] Length=450 Score = 414 bits (1067), Expect = 3e-114, Method: Composition-based stats. Identities = 112/436 (25%), Positives = 204/436 (46%), Gaps = 26/436 (5%) Query 3 KATDRKLVVGLEIGTAKVAALV---------------GEVLPDGMVNIIGVGSCPSRGMD 47 +A R +V L++G++K++ LV G + +IG + SRG+ Sbjct 23 QAMQRGVVAILDVGSSKISCLVLRFDGVTRLSEDNSIGSLAGQSGFRVIGAATTRSRGVQ 82 Query 48 KGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE 107 G V ++ + ++ A+ A+ MA+ ++ V +G V + +EVT+ Sbjct 83 FGEVCAMQETERAIRTAVQAAQKMAEVRVDHVIACFAGALPRSYGLDATVELEGQEVTEN 142 Query 108 DVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDM 167 ++ V+ + VLH P +A+D + G+++P G G + +H++T Sbjct 143 EIARVLAACEVPEYGAGREVLHAQPVNFALDNRSGLEDPRGQMGQALSVDMHMLTVEAAA 202 Query 168 AKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALR 227 +N+V+ V+RC L++ + + S S L EDE+ELG +D+GGGT ++++ + Sbjct 203 IQNLVRCVQRCDLELAGIASSAYVSGISALVEDEQELGAACIDMGGGTTSVSIFMKKHMI 262 Query 228 HTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RP 284 + + G+ VTSDI+ G P + AE IK G + + +++ G R Sbjct 263 YADAVRMGGDHVTSDISMGLGVPTATAERIKTMSGGVHATGADDRDMIDIGGETGDWERD 322 Query 285 PRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGL 344 R++ R L ++ PR E+L V + +L G H + IVLTGG++QI GL Sbjct 323 RRTVSRAELIGIMRPRVEEILEEV-------RVRLDAAGFDHLPSQQIVLTGGSSQILGL 375 Query 345 AACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 A R+ QVR+G P+ + GL P +++AVG+ + + + V Sbjct 376 DGLASRILGQQVRLGRPMRVHGLPQAVTGPGFASAVGMCLFAAHPQDEW-WDFDAPVDRM 434 Query 405 VGSWIKRLNSWLRKEF 420 G ++R+ W + + Sbjct 435 AGGSMRRVVRWFKDNW 450 >gi|86358444|ref|YP_470336.1| Gene info cell division protein [Rhizobium etli CFN 42] gi|86282546|gb|ABC91609.1| Gene info cell division protein [Rhizobium etli CFN 42] Length=443 Score = 414 bits (1065), Expect = 4e-114, Method: Composition-based stats. Identities = 126/427 (29%), Positives = 217/427 (50%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IG+ KV ++G + P + IIG+G SRG+ G + DL+++ Sbjct 24 IVSVLDIGSTKVVCMIGRLTPREESQILPGRTHNIEIIGIGHQRSRGIKTGVIADLDALE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 ++ A+D AE MA + S+ + L+ + + + +EV D++ V+ A Sbjct 84 GVIRLAVDAAERMAGLTVESLIVNLTAGRLGSDIYTATIDLGGQEVELNDLKKVLSAACQ 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 +R + VLH + +++D + GI++P+ + G + +H++T KN+ +V R Sbjct 144 QSLRQDRSVLHSLATGFSLDGERGIRDPLAMYGDALGVDMHVVTAERSALKNLELSVNRA 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ ++ AS + L +DE ELG +D+GGGT I+V+ G L HT + G+ Sbjct 204 HLSVEGIVATPYASGLAALVDDEVELGCAAIDMGGGTTTISVFAEGKLVHTDAVGLGGHH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 VT+D+A T DAE +KV H AL + + E + +P +G P + R ++ Sbjct 264 VTTDLARGLSTRIEDAERLKVVHASALLNSSDERELISIPPIGEDDRDQPSQVPRALVSR 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E + L+ + I ++ G + +VLTGGA+Q+ GLA A+R+ Sbjct 324 IVSARIEETMELIRDRI-------QRSGFSPIVGKRVVLTGGASQLTGLAEVARRILARN 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK--RVTASVGSWIKRLN 413 VRIG P+ ++GL A+ P +STAVGL+ Y + + + A S I R+ Sbjct 377 VRIGRPMGVSGLPTAAKGPAFSTAVGLMIYPQVADMETHASQSGLLMSLGGNNSRIARMG 436 Query 414 SWLRKEF 420 WL++ F Sbjct 437 QWLKESF 443 >gi|49238658|emb|CAF27904.1| Gene info Cell division protein ftsA [Bartonella henselae str. Houston-1] gi|49475850|ref|YP_033891.1| Gene info Cell division protein ftsA [Bartonella henselae str. Houston-1] Length=432 Score = 412 bits (1062), Expect = 9e-114, Method: Composition-based stats. Identities = 119/428 (27%), Positives = 199/428 (46%), Gaps = 20/428 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLE 55 + + L++G++K+ L+ + P + I+G G SRG+ G V D+ Sbjct 12 KTRFLTVLDVGSSKIVCLIACLRPLKHAHYLHGRTHSMEILGFGVQRSRGIKSGVVMDIF 71 Query 56 SVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHT 115 + + ++ A+D AE MA + SV + S + G+V ++ EVT+ D+ Sbjct 72 AAEQSIRLAVDAAEKMAGLVVDSVIVNFSSSRLQSALINGVVSLNGREVTKRDIRVAFAD 131 Query 116 AKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAV 175 E V+H +P Y +D +GI +PVG+ G VH++T +N+ + Sbjct 132 VSRKAFNAERHVVHSVPVSYVLDGDKGISDPVGMIGDFFGVDVHVVTAETAALRNLETCI 191 Query 176 ERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYA 235 R L V+ ++ AS +VL DE LG +D GGGT +V++ G H + Sbjct 192 NRAHLSVEAMVVTPFASGLAVLMNDEAHLGAACIDFGGGTTTFSVFSEGKFVHANALAVG 251 Query 236 GNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG-RPPRSLQRQTLA 294 G+ VT D+A F +AE +KV +G AL + + V V +G R L Sbjct 252 GHHVTLDVARGFSMSLPEAERLKVVYGSALVTSADERHMVNVTEIGNEHREIQYPRAVLG 311 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+L +V ++ L + G H + ++LTGGA+Q+ GL A+ + Sbjct 312 RIIRARVEEILEMV-------RDCLNRSGFGHIIGKRVILTGGASQLTGLPEMARTILGR 364 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA--EVEKRVTASVGSWIKRL 412 VRIG PL I+ L A+ +++AVGLL Y + + ++ + +R+ Sbjct 365 NVRIGRPLGISRLPSLAKGAAFTSAVGLLIYPQLVGFEEKTMQVAVNHLSTGTRGYFQRV 424 Query 413 NSWLRKEF 420 WLR+ F Sbjct 425 GQWLRESF 432 >gi|30526099|gb|AAP32281.1| FtsA [Bartonella henselae str. Houston-1] Length=433 Score = 412 bits (1062), Expect = 1e-113, Method: Composition-based stats. Identities = 119/428 (27%), Positives = 199/428 (46%), Gaps = 20/428 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLE 55 + + L++G++K+ L+ + P + I+G G SRG+ G V D+ Sbjct 13 KTRFLTVLDVGSSKIVCLIACLRPLKHAHYLHGRTHSMEILGFGVQRSRGIKSGVVMDIF 72 Query 56 SVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHT 115 + + ++ A+D AE MA + SV + S + G+V ++ EVT+ D+ Sbjct 73 AAEQSIRLAVDAAEKMAGLVVDSVIVNFSSSRLQSALINGVVSLNGREVTKRDIRVAFAD 132 Query 116 AKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAV 175 E V+H +P Y +D +GI +PVG+ G VH++T +N+ + Sbjct 133 VSRKAFNAERHVVHSVPVSYVLDGDKGISDPVGMIGDFFGVDVHVVTAETAALRNLETCI 192 Query 176 ERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYA 235 R L V+ ++ AS +VL DE LG +D GGGT +V++ G H + Sbjct 193 NRAHLSVEAMVVTPFASGLAVLMNDEAHLGAACIDFGGGTTTFSVFSEGKFVHANALAVG 252 Query 236 GNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG-RPPRSLQRQTLA 294 G+ VT D+A F +AE +KV +G AL + + V V +G R L Sbjct 253 GHHVTLDVARGFSMSLPEAERLKVVYGSALVTSADERHMVNVTEIGNEHREIQYPRAVLG 312 Query 295 EVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHT 354 +I R E+L +V ++ L + G H + ++LTGGA+Q+ GL A+ + Sbjct 313 RIIRARVEEILEMV-------RDCLNRSGFGHIIGKRVILTGGASQLTGLPEMARTILGR 365 Query 355 QVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEA--EVEKRVTASVGSWIKRL 412 VRIG PL I+ L A+ +++AVGLL Y + + ++ + +R+ Sbjct 366 NVRIGRPLGISRLPSLAKGAAFTSAVGLLIYPQLVGFEEKTMQVAVNHLSTGTRGYFQRV 425 Query 413 NSWLRKEF 420 WLR+ F Sbjct 426 GQWLRESF 433 >gi|83370089|ref|ZP_00914935.1| Cell division protein FtsA [Rhodobacter sphaeroides ATCC 17025] gi|83360236|gb|EAP63766.1| Cell division protein FtsA [Rhodobacter sphaeroides ATCC 17025] Length=444 Score = 412 bits (1060), Expect = 2e-113, Method: Composition-based stats. Identities = 114/438 (26%), Positives = 201/438 (45%), Gaps = 32/438 (7%) Query 4 ATDRKLVVGLEIGTAKVAAL---------------VGEVLPDGMVNIIGVGSCPSRGMDK 48 A R ++ L++G++K+ L VG + +IG + SRG+ Sbjct 18 AMQRGVIAILDVGSSKITCLILRFDGPDRLREHDGVGPMAGQSSFRVIGAATTRSRGVHF 77 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G ++ + + ++ A+ A+ MA+ ++ V +G G + + VT++D Sbjct 78 GEISVMNETERAIRTAVQAAQKMANVRVDHVIACFAGADPRSYGLAGEWELQDSVVTEQD 137 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 V V+ VLH P +A+D++ G+ +P G G R+ +HL+T D Sbjct 138 VARVMAACDVPDFGPGREVLHAQPVNFALDHRTGLGDPRGQIGNRLAVDMHLLTVEADAI 197 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +N++ ++RC L++ + + S S L EDE+ELG +D+GGG I+++ + Sbjct 198 QNLLHCIKRCDLELAGIASSAYVSGISSLVEDEQELGAACIDMGGGATGISIFIKKHMIF 257 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ VTSDI+ P + AE IK HG + + + E +++ + G Sbjct 258 ADSVRMGGDHVTSDISKGLQVPLATAEKIKTLHGGVVATGMDDREMIDIGADTGDWDKDR 317 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R++ R L ++ PR E+L + + +L G +H + IV+TGG +QI GL Sbjct 318 RTVSRAELIGIMRPRVEEILE-------EARARLDAAGFEHLPSQQIVITGGGSQIPGLD 370 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKRVT 402 A R+ +VR+G PL + GL P +S+AVGL + E E+ Sbjct 371 GLAARILGQRVRLGRPLRVQGLPQQVTGPGFSSAVGLCLFAAHPQDEWWDFEIPAERYPA 430 Query 403 ASVGSWIKRLNSWLRKEF 420 S+ IK W + + Sbjct 431 RSLRRAIK----WFKDNW 444 >gi|83953975|ref|ZP_00962696.1| cell division protein FtsA [Sulfitobacter sp. NAS-14.1] gi|83841920|gb|EAP81089.1| cell division protein FtsA [Sulfitobacter sp. NAS-14.1] Length=742 Score = 410 bits (1057), Expect = 4e-113, Method: Composition-based stats. Identities = 113/438 (25%), Positives = 204/438 (46%), Gaps = 32/438 (7%) Query 4 ATDRKLVVGLEIGTAKVAALV------GEVLPDGMV---------NIIGVGSCPSRGMDK 48 A R +V L++GT+K+A LV G V +G + +IG + SRG+ Sbjct 316 AMQRGVVAILDVGTSKIACLVLRFDGTGRVSEEGEIGSLAGQSGFRVIGAATTRSRGVRF 375 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G + ++ + V+ A+ A+ MA+ ++ V SG + + + V+++D Sbjct 376 GEICAMQETERAVRTALQAAQKMANIRVDHVIACFSGAEPRSYGLDAELDLEGQVVSEQD 435 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 V V+ + VLH P +A+D + G+ +P G G + +H++T Sbjct 436 VAQVLANCDVPEYGEGREVLHAQPVNFALDNRSGLSDPRGQLGNTLSVDMHMLTVDAAAV 495 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +++ ++RC L++ + + S S L EDE+ELG +D+GGG+ ++++ + + Sbjct 496 QHLAHCIKRCDLELAGVASSAYVSGISSLVEDEQELGAACIDLGGGSTSVSIFIRKHMIY 555 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ +TSDI+ P ++AE IK +G + + E +++ G Sbjct 556 ADSVRMGGDHITSDISMGLQVPTANAERIKTFYGGVHATGMDDREMIDIGGDTGDYEHDR 615 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R++ R L ++ PR E+L V + +L G H + IVLTGG +QI GL Sbjct 616 RTVSRAELIGIMRPRVEEILEEV-------RARLDAAGFDHLPSQQIVLTGGGSQIPGLD 668 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKRVT 402 A ++ QVR+G PL + GL A P +++AVGL + + ++ + Sbjct 669 GLASKILGQQVRLGRPLRVHGLPQAATGPGFASAVGLALFAAHPQDEWWDFDIPADRYPS 728 Query 403 ASVGSWIKRLNSWLRKEF 420 S +KR W R + Sbjct 729 RS----LKRAVKWFRDNW 742 >gi|24194053|gb|AAN47810.1| Gene info Cell division protein ftsA [Leptospira interrogans serovar Lai str. 56601] gi|24213311|ref|NP_710792.1| Gene info Cell division protein ftsA [Leptospira interrogans serovar Lai str. 56601] Length=409 Score = 410 bits (1057), Expect = 4e-113, Method: Composition-based stats. Identities = 140/420 (33%), Positives = 242/420 (57%), Gaps = 14/420 (3%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + +++ L++GT+ +V + + V IIG G+ PS G+ G + ++ES + + Sbjct 1 MSEPRDRIIAALDLGTSLTKVVVARPVSEYEVEIIGTGAYPSSGIKNGSIINIESTTRSI 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSV 119 A+ +AELM+ +IS V + ++GK + N G+V I+ + VT+ DV V+ A+++ Sbjct 61 IEAVSEAELMSGQEISVVAVNITGKTVKADNSKGVVAITNRDRTVTEPDVVRVIEAAQAI 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 RV + ++LHV+ +E+++D Q I++P+G++GVR++A+VH++T N+ K +E G Sbjct 121 RVPADQQILHVLSKEFSVDDQSSIRDPIGMTGVRLEAEVHIVTAGITAIHNLEKCIESSG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L + +I + LASS +VLT E++LG V+DIG G+ D+ VY G + ++ VIP+ G V Sbjct 181 LGCEVMILSSLASSEAVLTSGEKDLGTAVLDIGAGSCDLIVYVDGGISYSSVIPFGGINV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 TSDI+ T AE +K R+G + S + E++E+P + GRP R + R+ L +IEP Sbjct 241 TSDISIGLKTTLETAELLKKRYGHTILSEIDPTETIEIPPISGRPARQVLREELVSIIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R E+ +V++E L + G K LA G++LTGG + +EG+ A+ VF Sbjct 301 RMREIFEMVDKE-------LEKSGKKGFLAGGVILTGGGSLLEGIDTLAEDVFRLTSSRA 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ITGL + A P +STA+G++ Y +++++ W K++ W+ Sbjct 354 RPGGITGLAEKASSPEFSTAIGMIKYADRM-----TDMDQKSVDRSEGWSKKIRRWIEDN 408 >gi|52348006|gb|AAU40640.1| Gene info FtsA [Bacillus licheniformis DSM 13] gi|52785504|ref|YP_091333.1| Gene info FtsA [Bacillus licheniformis ATCC 14580] Length=432 Score = 409 bits (1054), Expect = 1e-112, Method: Composition-based stats. Identities = 129/386 (33%), Positives = 217/386 (56%), Gaps = 16/386 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L+IGT+ + +VGE+ D +NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDIGTSNIKVIVGEMSDD-SLNIIGVGNVPSEGLKKGSIVDIDETVHSIKKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRD 123 +QAE M ++ + ++G +I Q+ G+V +S +E+ EDV V+ A+ V + Sbjct 62 EQAERMIGFPLTHAIVGVNGNYIHIQDTNGVVAVSSENKEIHVEDVRRVMEAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPRQFIVDGRGDITDPKKMLGVRLEVEGSLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE+ LGV ++DIGGG+ +AV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSVALSKDEKNLGVALIDIGGGSTTVAVFEDGHLLATRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A ++E+ EV +G ++ ++ +A++IE R E Sbjct 242 SIGLRTSTDEAERVKKQFGHAFYEEASEEETFEVAVIGTDQKQTFTQREVADIIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EE LR G+K L G VLTGG A + G+ + AQ V VR+ +P Sbjct 302 IFLFVAEE-------LRNMGIK-ELPGGFVLTGGQAGMPGVLSLAQDVLQNNVRVASPNY 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKES 389 I +EP Y T VGL+ + + Sbjct 354 IG-----VREPQYMTGVGLIQFAYRN 374 >gi|88801283|ref|ZP_01116811.1| cell division protein FtsA [Polaribacter irgensii 23-P] gi|88781941|gb|EAR13118.1| cell division protein FtsA [Polaribacter irgensii 23-P] Length=442 Score = 409 bits (1053), Expect = 1e-112, Method: Composition-based stats. Identities = 135/406 (33%), Positives = 229/406 (56%), Gaps = 8/406 (1%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D K+ VGL+IGT K+ A++G + +IG+G S G+ +G V+++ ++ +Q+A+ Sbjct 3 DNKIAVGLDIGTTKIIAMIGRKNEYNKIEVIGIGKAKSLGVKRGVVSNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRD 123 ++AE ++ +I V + ++G+HI + + ++E + + D+EN+V+ + + Sbjct 63 EEAESVSGMKIEDVIVGIAGQHIRSLHHSDYITRNNADEVIEEADIENLVNQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQE+ +D Q IK P+G+ G R++A H++ +NI + V+ GL++ Sbjct 123 GEEIIHVLPQEFKVDSQADIKEPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLELS 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LAS+ +VL+ +E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 DITLEPLASASAVLSLEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A + E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKETEIVSIPGLRGREPKEITLKNLSKIIHARVQE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + K L AGIVLTGG AQ++ L + + R+G P Sbjct 303 IIEQVYLEIKNYGHET----AKGKLIAGIVLTGGGAQLKHLRQLVEYITGMDARVGFPNE 358 Query 363 NITGLTDYA-QEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGS 407 ++ G +D A P Y+TAVGLL G GEA VE+ + V S Sbjct 359 HLAGDSDEALSSPAYATAVGLLMEGLNKEFKGEAVVEEVLDEDVRS 404 >gi|76259137|ref|ZP_00766788.1| Cell division protein FtsA [Chloroflexus aurantiacus J-10-fl] gi|76165896|gb|EAO60025.1| Cell division protein FtsA [Chloroflexus aurantiacus J-10-fl] Length=415 Score = 409 bits (1053), Expect = 1e-112, Method: Composition-based stats. Identities = 142/423 (33%), Positives = 246/423 (58%), Gaps = 16/423 (3%) Query 1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60 M + R +VG+++GT+K+ +VG++ +NI+GVG PSRG+DKG V +++ Sbjct 1 MARTMAR-TIVGIDVGTSKICTIVGQIGDGRRLNILGVGMVPSRGIDKGVVVNIDDAATA 59 Query 61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE-VTQEDVENVVHTAKSV 119 ++ ++++AE + +IS ++ ++G+HIS N G+ + + +T++DV V A+ V Sbjct 60 IEASLEKAERASGLRISHAFVGVAGRHISSLNSRGVAAVQNPDGITRQDVARAVEAAQLV 119 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 + + ++HVIP+ Y ID +GI++P+G+SG+R++ + H+IT +N++++VER G Sbjct 120 ALPTQREIIHVIPRTYVIDGNDGIRDPIGMSGLRLEVETHIITGEAMAIQNLIRSVERAG 179 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 +++D L+ LA++ +VL++D++E GV ++DIGG T D+A++ G + HT VIP G Sbjct 180 VQIDDLVLQPLAAAEAVLSDDDKERGVMLIDIGGATTDLAIFAQGGVWHTGVIPVGGQHF 239 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCAL----GSIVGKDESVEVPSVGGRPPRSLQRQTLAE 295 T+DI Y TPP+ AE +K+R+G A+ + + + ++ ++ + + L + Sbjct 240 TNDIVYVLHTPPNTAEYLKLRYGSAIAGNPPAPGDESDLIDAETLTVGEKQQISAHLLKQ 299 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 V++ R EL+ L+ E R+ G + L AGIVLTGG AQ+ + Sbjct 300 VLQARAEELIELIVAE-------ARRSGYEGMLPAGIVLTGGGAQLSRFDDLLRDDLGLP 352 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSW 415 VRIG P + GLTD P Y+TAVGLL +G G E+ + S +R W Sbjct 353 VRIGIPGGLGGLTDSLDSPAYATAVGLLRWGVRY---GGRPPEQSSSDDTSSLYERFRRW 409 Query 416 LRK 418 LR+ Sbjct 410 LRE 412 >gi|45658797|ref|YP_002883.1| Gene info FtsA [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|45602041|gb|AAS71520.1| Gene info FtsA [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length=409 Score = 409 bits (1052), Expect = 1e-112, Method: Composition-based stats. Identities = 139/420 (33%), Positives = 241/420 (57%), Gaps = 14/420 (3%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61 + +++ L++GT+ +V + + V IIG G+ PS G+ G + ++ES + + Sbjct 1 MSEPRDRIIAALDLGTSLTKVVVARPVSEYEVEIIGTGAYPSSGIKNGSIINIESTTRSI 60 Query 62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSV 119 A+ +AELM+ +IS V + ++GK + N G+V I+ + VT+ DV V+ A+++ Sbjct 61 IEAVSEAELMSGQEISVVAVNITGKTVKADNSKGVVAITNRDRTVTEPDVVRVIEAAQAI 120 Query 120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179 RV + ++LHV+ +E+++D Q I++P+G++GVR++A+VH++T N+ K +E G Sbjct 121 RVPADQQILHVLSKEFSVDDQSSIRDPIGMTGVRLEAEVHIVTAGITAIHNLEKCIESSG 180 Query 180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239 L + +I + LASS +VLT E++LG V+DIG G+ D+ VY G + ++ VIP+ G V Sbjct 181 LGCEVMILSSLASSEAVLTSGEKDLGTAVLDIGAGSCDLIVYVDGGISYSSVIPFGGINV 240 Query 240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299 TSDI+ T AE +K R+G + S + E++E+P + GRP R + R+ L +IEP Sbjct 241 TSDISIGLKTTLETAELLKKRYGHTILSEIDPTETIEIPPISGRPARQVLREELVSIIEP 300 Query 300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359 R E+ +V++E L + G K LA G++LTGG + +EG+ A+ VF Sbjct 301 RMREIFEMVDKE-------LEKSGKKGFLAGGVILTGGGSLLEGIDTLAEDVFRLTSSRA 353 Query 360 APLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKE 419 P ITGL + A P +ST +G++ Y +++++ W K++ W+ Sbjct 354 RPGGITGLAEKASSPEFSTTIGMIKYADRM-----TDMDQKSVDRSEGWSKKIRRWIEDN 408 >gi|78493918|ref|ZP_00846149.1| Cell division protein FtsA [Rhodopseudomonas palustris BisB18] gi|78389041|gb|EAP11921.1| Cell division protein FtsA [Rhodopseudomonas palustris BisB18] Length=440 Score = 408 bits (1051), Expect = 2e-112, Method: Composition-based stats. Identities = 126/426 (29%), Positives = 200/426 (46%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A L+ + P + ++G SRG+ G V DL Sbjct 22 LVASLDIGTSKIACLIARLTPCPPNEALRGRSHAIELVGYSQIQSRGVKAGAVIDLAECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L++S + Q I VT +DV V Sbjct 82 RAVRQAVALAEGMAKVRVESVLLSVSAGRLQGQLVEASAEIRGGAVTSDDVTRVTSAGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y +D +GI++P G+ + ++++T +AKN++ VERC Sbjct 142 HATPQGRTVLHTLPVSYTLDGVKGIRDPRGMVARQFGVDMNVVTVDATVAKNLMLVVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE ++G VV++G GT IA Y+ G H G Sbjct 202 HLNVEAMAASPYVAGLSVLTDDEADIGAAVVEMGAGTTTIATYSAGRFVHASGFAVGGQH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 +T D+A GT +DAE IK +G L E + VPS G P+ + R +A Sbjct 262 ITMDLARGLGTCIADAERIKTLYGTVLTGGSDARELMSVPSAGDNERDAPQIISRAQIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L A +VL+GGA+Q+ GL A ++ Sbjct 322 IVRHRAEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGLPELATQILGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VRIG PL L A+ ++ GLL Y + +HL E + + ++ Sbjct 375 VRIGRPLGFGKLPSEAKSASFAVPTGLLVYPQYAHLEHVEPRNMRHHKTGTNGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|2688166|gb|AAC66648.1| Gene info cell division protein (ftsA) [Borrelia burgdorferi B31] gi|3023796|sp|Q44774|FTSA_BORBU Cell division protein ftsA gi|15594645|ref|NP_212434.1| Gene info cell division protein (ftsA) [Borrelia burgdorferi B31] gi|1165284|gb|AAA85623.1| FtsA Length=413 Score = 408 bits (1050), Expect = 3e-112, Method: Composition-based stats. Identities = 147/419 (35%), Positives = 250/419 (59%), Gaps = 10/419 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + + Sbjct 1 MSRNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNS 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVR 122 I+ AEL++ C I+S+ +++SG + N G+V I+ + E+ +EDVE V+ AK++ + Sbjct 61 IEAAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSKTREINEEDVERVIEAAKAIVIP 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + +LHVIPQE+ +D IKNP+ + G+R++ +VH+IT + ++N+V+ V R G V Sbjct 121 MDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSSSSSQNLVRCVNRAGFAV 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 D+++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT D Sbjct 181 DEVVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGS-IVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 IA + P AE IK+ G A S + + E+V +P++G RPP+ R+ L+ +I R Sbjct 241 IAQVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRL 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P Sbjct 301 REIFEMMKAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++I G+ + +P +S+A+GL+ Y E + + +L W KE+ Sbjct 354 MSINGIGEEHIDPKFSSALGLVLYKHEQQKFNKLKKVSSKVKRKNKISSKLKGWFLKEW 412 >gi|52003341|gb|AAU23283.1| Gene info cell-division protein [Bacillus licheniformis ATCC 14580] gi|52080130|ref|YP_078921.1| Gene info cell-division protein [Bacillus licheniformis ATCC 14580] Length=432 Score = 408 bits (1050), Expect = 3e-112, Method: Composition-based stats. Identities = 129/386 (33%), Positives = 217/386 (56%), Gaps = 16/386 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + +L V L+IGT+ + +VGE+ D +NIIGVG+ PS G+ KG + D++ V +++A Sbjct 3 NNELYVSLDIGTSNIKVIVGEMSDD-SLNIIGVGNVPSEGLKKGSIVDIDETVHSIKKAF 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRD 123 +QAE M ++ + ++G +I Q+ G+V +S +E+ EDV V+ A+ V + Sbjct 62 EQAERMIGFPLTHAIVGVNGNYIHIQDTNGVVAVSSENKEIHVEDVRRVMEAAQVVSIPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E ++ VIP+++ +D + I +P + GVR++ + LIT + N+++ VER G+++ Sbjct 122 EQLIVDVIPRQFIVDGRGDITDPKKMLGVRLEVEGSLITGSKTILHNLLRCVERAGIEIT 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LA+ L++DE+ LGV ++DIGGG+ +AV+ G L T+VIP G +T DI Sbjct 182 DICLQPLAAGSVALSKDEKNLGVALIDIGGGSTTVAVFEDGHLLATRVIPLGGENITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K + G A ++E+ EV +G ++ ++ +A++IE R E Sbjct 242 SIGLRTSTDEAERVKKQFGHAFYEEASEEETFEVAVIGTDQKQTFTQREVADIIEARLEE 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + V EE LR G+K L G VLTGG A + G+ + AQ V VR+ +P Sbjct 302 IFLFVAEE-------LRNMGIK-ELPGGFVLTGGQAGMPGVLSLAQDVLQNNVRVASPNY 353 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKES 389 I +EP Y T VGL+ + + Sbjct 354 IG-----VREPQYMTGVGLIQFAYRN 374 >gi|77387083|gb|ABA78268.1| Gene info cell division protein FtsA [Rhodobacter sphaeroides 2.4.1] gi|77462665|ref|YP_352169.1| Gene info cell division protein FtsA [Rhodobacter sphaeroides 2.4.1] gi|83375450|ref|ZP_00920211.1| Cell division protein FtsA [Rhodobacter sphaeroides ATCC 17029] gi|83363261|gb|EAP66760.1| Cell division protein FtsA [Rhodobacter sphaeroides ATCC 17029] Length=444 Score = 408 bits (1050), Expect = 3e-112, Method: Composition-based stats. Identities = 113/438 (25%), Positives = 202/438 (46%), Gaps = 32/438 (7%) Query 4 ATDRKLVVGLEIGTAKVAAL---------------VGEVLPDGMVNIIGVGSCPSRGMDK 48 A R ++ L++G++K+ L VG + +IG + SRG+ Sbjct 18 AMQRGVIAILDVGSSKITCLILRFDGPDRLREHDGVGPMAGQSSFRVIGAATTRSRGVHF 77 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G ++ + + ++ A+ A+ MA+ ++ V +G G + + VT++D Sbjct 78 GEISVMNETERAIRTAVQAAQKMANVRVDHVIACFAGADPRSYGLAGEWELQDSVVTEQD 137 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 V V+ VLH P +A+D++ G+ +P G G R+ +HL+T D Sbjct 138 VARVMAACDVPDFGQGREVLHAQPVNFALDHRTGLGDPRGQIGNRLAVDMHLLTVEADAI 197 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +N++ ++RC L++ + + S S L EDE+ELG +D+GGG ++++ + Sbjct 198 QNLLYCIKRCDLELAGIASSAYVSGVSSLVEDEQELGAACIDMGGGATGLSIFIKKHMIF 257 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ VTSDI+ P + AE IK RHG + + + E +++ + G Sbjct 258 ADSVRMGGDHVTSDISKGLQVPLATAEKIKTRHGGVVATGMDDREMIDIGADTGDWDKDR 317 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R++ R L ++ PR E+L + + +L G +H + IV+TGG +QI GL Sbjct 318 RTVSRAELIGIMRPRVEEILE-------EARARLDAAGFEHLPSQQIVITGGGSQIPGLD 370 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKRVT 402 A R+ +VR+G PL + GL P +S+AVGL + + E+ Sbjct 371 GLAARILGQRVRLGRPLRVQGLPQQVSGPGFSSAVGLCLFAAHPQDEWWDFDIPAERYPA 430 Query 403 ASVGSWIKRLNSWLRKEF 420 S+ IK W + + Sbjct 431 RSLRRAIK----WFKDNW 444 >gi|86140620|ref|ZP_01059179.1| cell division protein FtsA [Flavobacterium sp. MED217] gi|85832562|gb|EAQ51011.1| cell division protein FtsA [Flavobacterium sp. MED217] Length=448 Score = 407 bits (1048), Expect = 4e-112, Method: Composition-based stats. Identities = 124/394 (31%), Positives = 219/394 (55%), Gaps = 8/394 (2%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + + VGL+IGT K+ A++G + I+G+G S G+ +G VN++ ++ +Q+A+ Sbjct 4 KDIAVGLDIGTTKIVAMIGRYNEYQKLEILGIGKSKSLGVHRGVVNNITQTIQSIQQAVQ 63 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRDE 124 +AE ++ +I V + ++G+HI + +++ + +D++ + + + + Sbjct 64 EAESVSGMKIEDVVVGIAGQHIRSLQHSDYITRADADQVIGPKDIDMLCNQVHKLVMLPG 123 Query 125 HRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQ 184 ++HV+PQEY +D Q I P+G+ G R++A H++ +NI + V+ GL +D+ Sbjct 124 EEIIHVLPQEYKVDGQAEITQPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLNLDK 183 Query 185 LIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIA 244 + LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 184 ITLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDIK 243 Query 245 YAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTEL 304 AE +K++ G A +E V +P + GR P+ + + L+++I R E+ Sbjct 244 EGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEI 303 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-LN 363 + V EI + + K L AGIVLTGG +Q++ L + + RIG P + Sbjct 304 VEQVYLEIKNYGHEEQ----KKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNEH 359 Query 364 ITGLTD-YAQEPYYSTAVGLLHYGKESHLNGEAE 396 + G +D P Y+TAVGL+ E N E + Sbjct 360 LAGDSDSETTSPLYATAVGLVMNSLEHQHNSEDD 393 >gi|86132610|ref|ZP_01051203.1| cell division protein FtsA [Cellulophaga sp. MED134] gi|85816852|gb|EAQ38037.1| cell division protein FtsA [Cellulophaga sp. MED134] Length=449 Score = 407 bits (1048), Expect = 5e-112, Method: Composition-based stats. Identities = 130/390 (33%), Positives = 220/390 (56%), Gaps = 8/390 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 ++ + VGL+IGT K+ A++G V I+G+G S G+ +G VN++ ++ VQ+A+ Sbjct 3 NQNIAVGLDIGTTKIVAMIGRYNEYNKVEILGIGKSKSLGVHRGVVNNITQTIQSVQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISC-QNEIGMVPISEEEVTQ-EDVENVVHTAKSVRVRD 123 +AE ++ +I V + ++G+HI Q+ + + EEV +D+E + + + Sbjct 63 QEAEDVSGIKIKDVVVGIAGQHIRSLQHSDYITRNNSEEVIDAQDIEALCDQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQEY +D Q IK P+G+ G R++A H++ +NI + V+ GL +D Sbjct 123 GEEIIHVLPQEYKVDGQSEIKEPIGMYGGRVEANFHVVVGQVASIRNIGRCVKSAGLNLD 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GN++T DI Sbjct 183 RITLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNIITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A +E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + + K L AGIVLTGG +Q++ L + + RIG P Sbjct 303 IVEQVYLEIKNYGHEEQ----KKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNE 358 Query 363 NITGLTD-YAQEPYYSTAVGLLHYGKESHL 391 ++ G +D P Y+TAVGL+ E L Sbjct 359 HLAGDSDAETTSPLYATAVGLVMNSLEHGL 388 >gi|83949545|ref|ZP_00958278.1| cell division protein FtsA [Roseovarius nubinhibens ISM] gi|83837444|gb|EAP76740.1| cell division protein FtsA [Roseovarius nubinhibens ISM] Length=443 Score = 407 bits (1047), Expect = 6e-112, Method: Composition-based stats. Identities = 116/434 (26%), Positives = 200/434 (46%), Gaps = 25/434 (5%) Query 4 ATDRKLVVGLEIGTAKVAALV--------------GEVLPDGMVNIIGVGSCPSRGMDKG 49 A R +V L++GT+K+A LV G + +IG + SRG+ G Sbjct 18 AMQRGVVAVLDVGTSKIACLVLRFDGSPRLDAEGIGSMAGQAGFRVIGAATTRSRGVRFG 77 Query 50 GVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDV 109 ++ ++ + ++ A+ A+ MA+ ++ + SG G V + VT++D+ Sbjct 78 EISAMQETERAIRTAVQAAQKMANIRVDHIIACFSGAGPRSYGLAGSVDLEGNVVTEQDI 137 Query 110 ENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAK 169 V+ D VLH P +A+D++ G+ +P G G + +H++T + Sbjct 138 SRVLSACDVPDYGDGREVLHAQPVNFALDHRSGLIDPRGQLGQTLATDMHMLTVDAAAVQ 197 Query 170 NIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHT 229 N+ V+RC L++ + + + S L EDE+ELG +D+GGGT I+++ + + Sbjct 198 NLAHCVKRCDLELAGVASSAYMAGVSSLVEDEQELGAACIDLGGGTAGISIFIKKHMIYA 257 Query 230 KVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PPR 286 + G+ VTSDI+ P + AE IK +G + + + E +E+ G R Sbjct 258 DSVRMGGDHVTSDISKGLSVPTATAERIKTFYGGVVATGMDDREMIEIGGDTGDYEHDRR 317 Query 287 SLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAA 346 + R L ++ PR E+L V + +L G +H + IVLTGG +QI GL Sbjct 318 RVSRAELIGIMRPRVEEILEEV-------RARLDAAGFEHLPSQQIVLTGGGSQIPGLDG 370 Query 347 CAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG 406 A R+ QVR+G PL + GL A +++AVGL + + + V Sbjct 371 LASRILGQQVRLGRPLRVHGLPQAATGAGFASAVGLCLFAANPQDEW-WDFDLPVDRYPA 429 Query 407 SWIKRLNSWLRKEF 420 +KR W + + Sbjct 430 RSLKRAVKWFKDNW 443 >gi|78698366|ref|ZP_00862869.1| Cell division protein FtsA [Bradyrhizobium sp. BTAi1] gi|78513896|gb|EAP27204.1| Cell division protein FtsA [Bradyrhizobium sp. BTAi1] Length=439 Score = 406 bits (1046), Expect = 7e-112, Method: Composition-based stats. Identities = 128/426 (30%), Positives = 206/426 (48%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L++GT+K+A ++ + P V +IG SRG+ G V D + Sbjct 21 LVASLDVGTSKIACMIARLRPAPPSDALRGRTHAVELIGYSQIQSRGVKAGAVVDPVACE 80 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L ++G + I VTQ DV V T Sbjct 81 QAVRQAVALAERMAKVRVESVLLPVAGGRVMGHLIEATSDIRGGAVTQADVSRVTSTGMH 140 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 + VLH +P Y +D +GI++P G+ + ++++T +AKN++ VERC Sbjct 141 HATGEGRAVLHALPVGYTLDGVKGIRDPRGMLARQFGVDMNVVTADATVAKNLMLVVERC 200 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE +LG VV++G GT IA Y+GG H G+ Sbjct 201 HLNVEAMAASPYVAGLSVLTDDEADLGAAVVEMGAGTTTIATYSGGRFVHASGFALGGHH 260 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 VT D+A +DAE IK +G L E + VP+ G P+ + R T+A Sbjct 261 VTMDLARGLSACIADAERIKTLYGTVLTGGSDARELMSVPTAGDNERDVPQIVSRATIAN 320 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L+ A +VL+GGA+Q+ GL A R+ Sbjct 321 IVRHRAEEIFEMV-------RDRLKDSPFAAEPKARVVLSGGASQLTGLVELATRILDRP 373 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VR+G PL L + A+ ++ GLL Y + +HL E ++V + ++ Sbjct 374 VRVGRPLGFGRLPNEAKNAAFAVPTGLLVYPQYAHLEHVEPRHTRQVGTGTDGYFGKVGR 433 Query 415 WLRKEF 420 WLR+ F Sbjct 434 WLREGF 439 >gi|27354877|dbj|BAC51862.1| Gene info cell division protein [Bradyrhizobium japonicum USDA 110] gi|27381708|ref|NP_773237.1| Gene info cell division protein [Bradyrhizobium japonicum USDA 110] Length=440 Score = 406 bits (1046), Expect = 7e-112, Method: Composition-based stats. Identities = 127/433 (29%), Positives = 207/433 (47%), Gaps = 21/433 (4%) Query 2 IKATDRKLVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGV 51 + LV L+IGT+K+A ++ + P V +IG SRGM G V Sbjct 15 MPHKRGGLVACLDIGTSKIACMIARLKPSAPSEALRGRTHAVELIGYSQIQSRGMKAGAV 74 Query 52 NDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVEN 111 DL + V++A+ AE MA ++ SV L++SG +S Q I VT DV Sbjct 75 VDLGECEQAVRQAVGLAEKMAKVRVESVLLSVSGGRLSGQLVEAAADIRGGAVTPADVSR 134 Query 112 VVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNI 171 V T + VLH +P Y +D +GI++P G+ + ++++TC +A+N+ Sbjct 135 VTSTGMRHATGEGRTVLHALPVGYTLDGVKGIRDPRGMVAHQFGVDMNVVTCDATVARNL 194 Query 172 VKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKV 231 + AVERC + V+ + + + SVLT+DE +LG VV++G GT +AVY GG H Sbjct 195 MLAVERCHINVEAMAASPYVAGLSVLTDDEADLGAAVVEMGAGTTTMAVYAGGRFVHAAG 254 Query 232 IPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP--PRSLQ 289 G +T D+A +DAE IK +G + E + VP+ G P+ + Sbjct 255 FAVGGQHITMDLARGLSATIADAERIKTLYGTVITGGSDSRELMSVPTAGDEQDLPQIVS 314 Query 290 RQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQ 349 R T+A +++ R E+ +V +++L+ +VL+GGA+Q+ GL Sbjct 315 RATIANIVKHRAEEIFEMV-------RDRLKDSPFASEPNGRVVLSGGASQLTGLVELGT 367 Query 350 RVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG--EAEVEKRVTASVGS 407 ++ VR+G PL L + A+ ++ GLL Y + H ++V G Sbjct 368 QILGRPVRVGRPLGFGRLPNEAKNAAFAVPAGLLVYPQYVHQEHVEPRHTRQQVRTGTGG 427 Query 408 WIKRLNSWLRKEF 420 + ++ WLR+ F Sbjct 428 YFGKVGRWLREGF 440 >gi|66798160|ref|ZP_00396916.1| Cell division protein FtsA [Deinococcus geothermalis DSM 11300] gi|66781526|gb|EAL82494.1| Cell division protein FtsA [Deinococcus geothermalis DSM 11300] Length=448 Score = 406 bits (1046), Expect = 7e-112, Method: Composition-based stats. Identities = 142/384 (36%), Positives = 222/384 (57%), Gaps = 8/384 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 D ++VGL+IGT K+ ++GEV P+G V+IIG GS PS GM +G V +LE +++ Sbjct 1 MKDNPIIVGLDIGTTKITTVIGEVAPNGTVDIIGEGSVPSEGMKRGAVVNLERATHAIRQ 60 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPIS-EEEVTQEDVENVVHTAKSVRVR 122 ++ AE ++ ++SSV+++++G H G+ I +++TQ DV+ + A++V + Sbjct 61 SVQSAERVSGVRVSSVFVSVAGNHAKAITSHGLAAIRRNQQITQADVDRSIENARAVPLD 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 ++H +PQEY +D QEGIKNPVG+ GVR++ VH++ N+ + V+ GLKV Sbjct 121 PNLEIIHTLPQEYVVDGQEGIKNPVGMHGVRLEVDVHIVAGTAGPLLNLRRCVQEAGLKV 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 + + LAS + L E+ V V+D+GGGT D+ V+ G L H+ IP G VT+D Sbjct 181 EGFVLQALASGLATLEAAEQAQTVIVIDMGGGTTDVGVFKRGNLAHSACIPLGGEHVTAD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYT 302 +A P +AE +K R+G AL + D ++E+ S G ++ L+ +I+PR T Sbjct 241 LAQILKIPHEEAENVKRRYGSALPELADPDLTLEITSANG-ATHAISAFELSRIIKPRLT 299 Query 303 ELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPL 362 E+ +V +EI Q G +A +VLTGGA+Q+ G A+ F VR+G P Sbjct 300 EIFGMVRDEIDQ------ALGPVELVAQSVVLTGGASQLRGTTELARDRFRLPVRLGRPR 353 Query 363 NITGLTDYAQEPYYSTAVGLLHYG 386 I GLTD P ++T VGL+ YG Sbjct 354 GIGGLTDIVSGPAHATGVGLVLYG 377 >gi|85703760|ref|ZP_01034864.1| cell division protein FtsA [Roseovarius sp. 217] gi|85672688|gb|EAQ27545.1| cell division protein FtsA [Roseovarius sp. 217] Length=444 Score = 406 bits (1046), Expect = 8e-112, Method: Composition-based stats. Identities = 113/435 (25%), Positives = 198/435 (45%), Gaps = 26/435 (5%) Query 4 ATDRKLVVGLEIGTAKVAALV---------------GEVLPDGMVNIIGVGSCPSRGMDK 48 A R +V L++GT+K+A LV G + +IG + SRG+ Sbjct 18 AMQRGVVAVLDVGTSKIACLVLRFDGTERLHEAEGIGRMAGQAGFRVIGAATTRSRGVRF 77 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G ++ + + ++ A+ A+ MA+ ++ V SG G V + V+++D Sbjct 78 GEIDAMAETERAIRTAVQAAQKMANIRVDHVIACFSGAGPRSYGLAGQVELEGHTVSEQD 137 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 + V+ + VLH P +A+D++ G+ +P G G + +H++T Sbjct 138 ISRVLSACDVPDFGEGREVLHAQPVNFALDHRSGLIDPRGQMGQVLSTDMHMLTVDGAAI 197 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +N+ V+RC L++ + + S + L EDE+ELG +D+GGGT ++++ + + Sbjct 198 QNLAYCVKRCDLELAGVASSAYVSGIAALVEDEQELGAACIDLGGGTSGVSIFIKKHMIY 257 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ VT+DI+ P + AE IK +G + + + E +E+ G Sbjct 258 ADSVRMGGDHVTNDISMGLQVPQATAERIKTFYGGVVATGMDDREMIEIGGDTGDYEHDR 317 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R + R L ++ PR E+L V + +L G H + IVLTGG +QI GL Sbjct 318 RRVSRAELIGIMRPRVEEILEEV-------RARLDAAGFDHLPSQQIVLTGGGSQIPGLD 370 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASV 405 A ++ QVR+G PL + GL A +++AVG+ + + E V Sbjct 371 GLASKILGQQVRLGRPLRVHGLPQAATGAGFASAVGMCLFAANPQDEW-WDFEIPVDRYP 429 Query 406 GSWIKRLNSWLRKEF 420 +KR W R + Sbjct 430 ARSLKRAMKWFRDNW 444 >gi|74420120|gb|ABA04319.1| Gene info Cell division protein FtsA [Nitrobacter winogradskyi Nb-255] gi|75675250|ref|YP_317671.1| Gene info Cell division protein FtsA [Nitrobacter winogradskyi Nb-255] Length=440 Score = 406 bits (1045), Expect = 1e-111, Method: Composition-based stats. Identities = 135/436 (30%), Positives = 209/436 (47%), Gaps = 24/436 (5%) Query 2 IKATDRK---LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDK 48 ++ R LV L+IGT+K+A ++ + P V +IG SRGM Sbjct 12 MRPMQRNRSALVASLDIGTSKIACMIARLRPSAPNDALRGRTHAVELIGYSQIQSRGMKA 71 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G V DL + V++A+ AE MA ++ SV L +S + Q I VT D Sbjct 72 GAVTDLAQCEQAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSD 131 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 + V T VLH +P Y++D +GI++P G+ R ++++T +A Sbjct 132 ISRVTSTGMHHATASGRTVLHALPAGYSLDGVKGIRDPRGMVARRFGVDMNVVTTEATVA 191 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 KN++ AVERC L V+ + + + SVLT+DE +LG VV++G GT IAVY+ G + Sbjct 192 KNLMLAVERCHLTVEAMAASPYVAGLSVLTDDEVDLGAAVVEMGAGTTTIAVYSAGRFIY 251 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPP 285 G+ VT D+A G +DAE IK +G L E + VP+ G P Sbjct 252 ASGFAIGGHHVTMDLARGLGACIADAERIKTLYGTVLTGGSDVRELMTVPAAGDSDCDAP 311 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 + + R T+A ++ R E+ +V +++L A +VL+GGA+Q+ G+ Sbjct 312 QVVSRATIANIVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGVP 364 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTAS 404 A RV VRIG PL L + A+ +S GLL Y + +HL E ++V Sbjct 365 ELASRVLGRPVRIGRPLGFGRLPNEAKSASFSVPTGLLVYPQYAHLEHVEPRRTRQVRTG 424 Query 405 VGSWIKRLNSWLRKEF 420 + ++ WLR+ F Sbjct 425 TDGYFGKVGRWLREGF 440 >gi|1200208|emb|CAA78155.1| ftsA [Borrelia burgdorferi] gi|1234875|emb|CAA65463.1| ftsA [Borrelia burgdorferi] Length=413 Score = 406 bits (1045), Expect = 1e-111, Method: Composition-based stats. Identities = 147/419 (35%), Positives = 249/419 (59%), Gaps = 10/419 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + + Sbjct 1 MSRNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNS 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVR 122 I+ AEL++ C I+S+ +++SG + N G+V I+ + E+ +EDVE V+ AK++ + Sbjct 61 IEAAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSKTREINEEDVERVIEAAKAIVIP 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + +LHVIPQE+ +D IKNP+ + G+R++ VH+IT + ++N+V+ V R G V Sbjct 121 MDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGGVHIITGSSSSSQNLVRCVNRAGFAV 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 D+++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT D Sbjct 181 DEVVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGS-IVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 IA + P AE IK+ G A S + + E+V +P++G RPP+ R+ L+ +I R Sbjct 241 IAQVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRL 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P Sbjct 301 REIFEMMKAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++I G+ + +P +S+A+GL+ Y E + + +L W KE+ Sbjct 354 MSINGIGEEHIDPKFSSALGLVLYKHEQQKFNKLKKVSSKVKRKNKISSKLKGWFLKEW 412 >gi|69928979|ref|ZP_00625993.1| Cell division protein FtsA [Nitrobacter hamburgensis X14] gi|69142144|gb|EAN60709.1| Cell division protein FtsA [Nitrobacter hamburgensis X14] Length=440 Score = 405 bits (1044), Expect = 1e-111, Method: Composition-based stats. Identities = 130/426 (30%), Positives = 206/426 (48%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P V +IG SRGM G V DL Sbjct 22 LVASLDIGTSKIACMIARLKPSAPNEALRGRTHTVELIGYSQIQSRGMKAGAVVDLAQCE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V++A+ AE MA ++ SV L +S + Q I VT DV V+ Sbjct 82 QAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSDVSRVISAGMR 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y++D +GI++P G+ R ++++T +AKN++ AVERC Sbjct 142 HATAPGRTVLHALPVGYSLDGVKGIRDPRGMVARRFGVDMNVVTSEATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT DE +LG VV++G GT IA+Y+ G H G+ Sbjct 202 HLTVEAMAASPYVAGLSVLTGDEADLGAAVVEMGAGTTTIAIYSAGRFVHASGFAVGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPPRSLQRQTLAE 295 VT D+A G +DAE IK +G L + + VP+ G P+ + R T+A Sbjct 262 VTMDLARGLGACIADAERIKTLYGTVLTGGSDVRQLMTVPAAGDSDSDAPQVVSRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V +++L A +VL+GGA+Q+ G+ A+R+ Sbjct 322 IVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGVPELARRILGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VRIG PL L + A+ ++ GLL Y + +HL E +++ + ++ Sbjct 375 VRIGRPLGFGRLPNEAKSASFAVPTGLLVYPQYAHLEHVEPRHTRQLRTGTDGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|77688127|ref|ZP_00803312.1| Cell division protein FtsA [Rhodopseudomonas palustris BisB5] gi|77655402|gb|EAO87043.1| Cell division protein FtsA [Rhodopseudomonas palustris BisB5] Length=441 Score = 405 bits (1042), Expect = 2e-111, Method: Composition-based stats. Identities = 121/427 (28%), Positives = 205/427 (48%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLPD----------GMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IGT+K+A ++ + P + ++G SRG+ G V D+ Sbjct 22 MVASLDIGTSKIACMIARLKPTPPKDALRGRSHAIELVGYSQIQSRGVKAGAVVDMVECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 K ++ A+ AE MA ++ SV L++S + Q I VT +DV V T Sbjct 82 KAIRHAVALAERMAKVRVESVLLSVSAGRLQGQLIEAAADIKGGAVTADDVSRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y +D +GI++P G+ + ++++T +AKN++ AVERC Sbjct 142 HATAPGRAVLHALPVGYTLDGVKGIRDPRGMVARQFGVDMNVVTADATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE ++G ++++G GT +A+Y+ G H G+ Sbjct 202 HLNVEAMAASPYVAGLSVLTDDEADIGAALIEMGAGTTTMAIYSAGRFVHASGFALGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 +T D+A G +DAE IK +G L E + +P+ G P+ + R T+A Sbjct 262 ITMDLARGLGACIADAERIKTLYGTVLTGGSDARELMSIPAAGDNERDTPQVISRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 +I R E+ +V +++L A +VL+GGA+Q+ G+ A R+ Sbjct 322 IIRHRAEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGIPELATRILGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVG-SWIKRLN 413 VR+G PL L A+ ++ GLL Y + +HL E + V + + ++ Sbjct 375 VRVGRPLGFGRLPTEAKSASFAVPSGLLVYPQYAHLEHIEPRYSRHVRTAGRAGYFGKVG 434 Query 414 SWLRKEF 420 WLR+ F Sbjct 435 RWLREGF 441 >gi|83942735|ref|ZP_00955196.1| cell division protein FtsA [Sulfitobacter sp. EE-36] gi|83846828|gb|EAP84704.1| cell division protein FtsA [Sulfitobacter sp. EE-36] Length=434 Score = 405 bits (1042), Expect = 2e-111, Method: Composition-based stats. Identities = 113/438 (25%), Positives = 204/438 (46%), Gaps = 32/438 (7%) Query 4 ATDRKLVVGLEIGTAKVAALV------GEVLPDGMV---------NIIGVGSCPSRGMDK 48 A R +V L++GT+K+A LV G V +G + +IG + SRG+ Sbjct 8 AMQRGVVAILDVGTSKIACLVLRFDGTGRVSEEGEIGSLAGQSGFRVIGAATTRSRGVRF 67 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G + ++ + V+ A+ A+ MA+ ++ V SG + + + V+++D Sbjct 68 GEICAMQETERAVRTALQAAQKMANIRVDHVIACFSGAEPRSYGLDAALDLEGQVVSEQD 127 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 V V+ + VLH P +A+D + G+ +P G G + +H++T Sbjct 128 VAQVLANCDVPEYGEGREVLHAQPVNFALDNRSGLSDPRGQLGNTLSVDMHMLTVDAAAV 187 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +++ ++RC L++ + + S S L EDE+ELG +D+GGG+ ++++ + + Sbjct 188 QHLAHCIKRCDLELAGVASSAYVSGISSLVEDEQELGAACIDLGGGSTSVSIFIRKHMIY 247 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ +TSDI+ P ++AE IK +G + + E +++ G Sbjct 248 ADSVRMGGDHITSDISMGLQVPTANAERIKTFYGGVHATGMDDREMIDIGGDTGDYEHDR 307 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R++ R L ++ PR E+L V + +L G H + IVLTGG +QI GL Sbjct 308 RTVSRAELIGIMRPRVEEILEEV-------RARLDAAGFDHLPSQQIVLTGGGSQIPGLD 360 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKRVT 402 A ++ QVR+G PL + GL A P +++AVGL + + ++ + Sbjct 361 GLASKILGQQVRLGRPLRVHGLPQAATGPGFASAVGLALFAAHPQDEWWDFDIPADRYPS 420 Query 403 ASVGSWIKRLNSWLRKEF 420 S +KR W R + Sbjct 421 RS----LKRAVKWFRDNW 434 >gi|77741184|ref|ZP_00809668.1| Cell division protein FtsA [Rhodopseudomonas palustris BisA53] gi|77698830|gb|EAO89978.1| Cell division protein FtsA [Rhodopseudomonas palustris BisA53] Length=442 Score = 405 bits (1042), Expect = 2e-111, Method: Composition-based stats. Identities = 126/426 (29%), Positives = 204/426 (47%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 LV L+IGT+K+A ++ + P + +IG SRG+ G V DL Sbjct 24 LVASLDIGTSKIACMIARLTPCPPNNALRGRTHAIELIGYSQIQSRGVKAGAVVDLAECE 83 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 + V+ A+ AE MA ++ SV L++SG + Q + VTQ DV V Sbjct 84 RAVRHAVALAEGMAKVRVESVLLSVSGGRLQGQLVEASANVHGGAVTQADVARVTSAGMR 143 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 V+H +P Y ++ +GI++P G+ + ++++T +AKN++ VERC Sbjct 144 HATGQGRTVMHALPVSYTLEGVKGIRDPRGMVARQFGVDMNVVTVDATVAKNLMLVVERC 203 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L V+ + + + SVLT+DE ++G V+++G GT IA Y+ G H G Sbjct 204 HLNVEAMAASPYVAGLSVLTDDEADIGAAVIEMGAGTTTIATYSAGRFVHAGGFAVGGQH 263 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 +T D+A G +DAE IK +G L E + VPS G P+ + R T+A Sbjct 264 ITMDLARGLGACIADAERIKTLYGTVLTGGSDARELLTVPSAGDNERDVPQVISRATIAN 323 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 ++ R E+ +V ++KL Q A +VL+GGA+Q+ GL A R+ Sbjct 324 IVRHRAEEIFEMV-------RDKLAQSPFAAEPRARVVLSGGASQLTGLPELATRILGRP 376 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASVGSWIKRLNS 414 VR+G PL L A+ ++ GLL Y + +HL E ++ + ++ ++ Sbjct 377 VRVGRPLGFGRLPQEAKTASFAVPCGLLVYPQYAHLEHVEPRHSQQPRSGTNGYLGKVGR 436 Query 415 WLRKEF 420 WLR+ F Sbjct 437 WLREGF 442 >gi|51573132|gb|AAU07157.1| Gene info cell division protein [Borrelia garinii PBi] gi|51598561|ref|YP_072749.1| Gene info cell division protein [Borrelia garinii PBi] Length=413 Score = 404 bits (1040), Expect = 4e-111, Method: Composition-based stats. Identities = 147/419 (35%), Positives = 249/419 (59%), Gaps = 10/419 (2%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 R L+VGL++GT+K+ +V EV + + I+G+G+ SRG+ KG + ++E+ + + + Sbjct 1 MSRNLIVGLDVGTSKICTVVAEVNLNDQLEIVGIGTSISRGVRKGVLINIEAALDSISNS 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVR 122 I+ AEL++ C I+S+ +++SG + N G+V I+ E+ +EDVE V+ AK++ + Sbjct 61 IEAAELISGCDITSLSVSMSGSSVEGTNSRGVVAINSRTREINEEDVERVIEAAKAIVIP 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 + +LHVIPQE+ +D IKNP+ + G+R++ +VH+IT + ++N+V+ V R G V Sbjct 121 MDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSSSSSQNLVRCVNRAGFAV 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 D+++ LASSY+ L+++ERE+GV +D+G GT DI +Y G+ +T VIP N VT D Sbjct 181 DEVVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYIDGSPYYTGVIPIGVNRVTLD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGS-IVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 IA + P AE IK+ G A S + + E+V +P++G RPP+ R+ L+ +I R Sbjct 241 IAQVWKVPEDVAENIKITAGIAHPSILESQMETVIIPNLGTRPPQEKSRKELSVIINSRL 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+ ++ EIL ++G+ + + GIVLTGG A G++ + VF+ RIG P Sbjct 301 REIFEIMRAEIL-------KRGLYNKINGGIVLTGGGALFPGISNLIEEVFNYPARIGLP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++I G+ + +P +S+A+GL+ Y E + + +L W KE+ Sbjct 354 MSINGVGEKHIDPKFSSALGLVLYKHEHQKFIKLKKVSSKVKRKNKISSKLKGWFLKEW 412 >gi|84501761|ref|ZP_00999933.1| cell division protein FtsA [Oceanicola batsensis HTCC2597] gi|84390382|gb|EAQ02941.1| cell division protein FtsA [Oceanicola batsensis HTCC2597] Length=443 Score = 404 bits (1039), Expect = 5e-111, Method: Composition-based stats. Identities = 111/434 (25%), Positives = 202/434 (46%), Gaps = 25/434 (5%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGM--------------VNIIGVGSCPSRGMDKG 49 A R +V L++G++K+A LV + G +IG + SRG++ G Sbjct 18 ALQRGVVAVLDVGSSKIACLVLRIDQTGTTARGDSGSLAGQAGFRVIGAATTRSRGVNFG 77 Query 50 GVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDV 109 ++ + + ++ A+ A+ MA+ ++ V SG G + + ++ V+++D+ Sbjct 78 EIDAMPEAERAIRTAVQAAQKMANIRVDHVIACFSGAAPRSYGLAGEIEVEDQAVSEQDI 137 Query 110 ENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAK 169 V+ VLH P +A+D++ G+ +P G G + +H++T + Sbjct 138 SRVLAACDVPDYGPGREVLHAQPVNFALDHRSGLSDPRGQIGHVLSTDLHMLTVDATAVQ 197 Query 170 NIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHT 229 N+ ++RC L++ + + + S L EDE+ELG +D+GGGT ++++ + + Sbjct 198 NLAYCLKRCDLELAGVASSAYVTGISSLVEDEQELGAACIDMGGGTTGLSIFMKKHMIYA 257 Query 230 KVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PPR 286 + G+ VTSDI+ A P S AE IK +G + + E +E+ S G R Sbjct 258 DTVRMGGDHVTSDISMALQIPASHAERIKTFYGGVVATGRDDLERIELKSETGDWNHDRR 317 Query 287 SLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAA 346 + L ++ PR E+L V + +L G H + IVLTGGA+QI GL Sbjct 318 EVSVAELIGIMRPRVEEILEEV-------RHRLDAAGFDHLPSQQIVLTGGASQIPGLDG 370 Query 347 CAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVG 406 A R+ +VR+G PL + GL A P ++++VG+ + + E + Sbjct 371 LASRILGQRVRLGRPLRVHGLPQAATGPGFASSVGMCLFAARPQDEW-WDFEVPIDRYPA 429 Query 407 SWIKRLNSWLRKEF 420 ++R W + + Sbjct 430 KSLRRAVRWFKDNW 443 >gi|86134324|ref|ZP_01052906.1| cell division protein FtsA [Tenacibaculum sp. MED152] gi|85821187|gb|EAQ42334.1| cell division protein FtsA [Tenacibaculum sp. MED152] Length=441 Score = 403 bits (1038), Expect = 7e-111, Method: Composition-based stats. Identities = 129/387 (33%), Positives = 224/387 (57%), Gaps = 8/387 (2%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 D K+ VGL+IGT K+ A++G G + ++G+G S G+ +G V+++ ++ +Q+A+ Sbjct 3 DNKIAVGLDIGTTKIVAMIGRKNEYGKIEVVGIGKAKSLGVKRGVVSNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRD 123 D+AE ++ +I V + ++G+HI + + ++E + + D+E++V+ + + Sbjct 63 DEAESVSGVKIEDVVVGIAGQHIRSLHHSDYITRNNADEVIDEADIEDLVNQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQE+ +D Q IK P+G+ G R++A H++ +NI + V+ GL ++ Sbjct 123 GEEIIHVLPQEFKVDSQADIKEPIGMYGGRLEANFHVVVGQVSSIRNIGRCVKSAGLDLN 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 ++ LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 EITLEPLASAQAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITDDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A + E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKETEIVSIPGLRGREPKEITLKNLSKIIHARVQE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-L 362 ++ V EI + K L AGIVLTGG +Q++ L + + RIG P Sbjct 303 IIEHVYLEIKNYGHET----AKGKLIAGIVLTGGGSQLKHLRQLVEYITGMDARIGYPNE 358 Query 363 NITGLTDYA-QEPYYSTAVGLLHYGKE 388 ++ G +D A P Y+TAVGLL G E Sbjct 359 HLAGESDEALSSPSYATAVGLLMEGLE 385 >gi|86749126|ref|YP_485622.1| Gene info cell division protein FtsA [Rhodopseudomonas palustris HaA2] gi|86572154|gb|ABD06711.1| Gene info cell division protein FtsA [Rhodopseudomonas palustris HaA2] Length=441 Score = 402 bits (1035), Expect = 1e-110, Method: Composition-based stats. Identities = 123/427 (28%), Positives = 208/427 (48%), Gaps = 22/427 (5%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IGT+K+A ++ + P V ++G SRG+ G V D+ Sbjct 22 MVASLDIGTSKIACMIARLKPCPPKDALRGRSHAVELVGYSQIQSRGVKAGAVVDMVECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 K ++ A+ AE MA ++ SV L++S + Q I VT +DV V T Sbjct 82 KAIRHAVALAERMAKVRVESVLLSVSAGRLQGQLIEAAADIKGGAVTADDVSRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y +D +GI++P G+ + ++++T +AKN++ AVERC Sbjct 142 HATAPGRAVLHALPVGYTLDGVKGIRDPRGMVARQFGVDMNVVTADATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L+V+ + + + SVLT+DE ++G ++++G GT +AVY+ G H G+ Sbjct 202 HLEVEAMAASPYVAGLSVLTDDEADIGAALIEMGAGTTTMAVYSAGRFVHAGGFALGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP---PRSLQRQTLAE 295 +T D+A G +DAE IK +G L E + +P+ G P+ + R T+A Sbjct 262 ITMDLARGLGACIADAERIKTLYGTVLTGGSDARELMSIPAAGDNERDAPQVISRATIAN 321 Query 296 VIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQ 355 +I R E+ +V +++L A +VL+GGA+Q+ G+ A R+ Sbjct 322 IIRHRAEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGIPELATRILGRP 374 Query 356 VRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASV-GSWIKRLN 413 VR+G PL L A+ ++ GLL Y + +HL E ++V ++ + ++ Sbjct 375 VRVGRPLGFGRLPTEAKSASFAVPTGLLVYPQYAHLEHIEPRHARQVRSADHAGYFGKVG 434 Query 414 SWLRKEF 420 WLR+ F Sbjct 435 RWLREGF 441 >gi|85714981|ref|ZP_01045966.1| Cell division protein FtsA [Nitrobacter sp. Nb-311A] gi|85698178|gb|EAQ36050.1| Cell division protein FtsA [Nitrobacter sp. Nb-311A] Length=440 Score = 402 bits (1034), Expect = 2e-110, Method: Composition-based stats. Identities = 134/436 (30%), Positives = 208/436 (47%), Gaps = 24/436 (5%) Query 2 IKATDRK---LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDK 48 + R LV L+IGT+K+A ++ + P V +IG SRGM Sbjct 12 TRPMQRNRGALVASLDIGTSKIACMIARLRPSAPNDALRGRTHAVELIGYSQIQSRGMKA 71 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G V DL + V++A+ AE MA ++ SV L +S + Q I VT D Sbjct 72 GAVTDLAQCEQAVRQAVSLAEQMAKVRVESVLLPVSAGRLQGQLIEAASHIQGGAVTPSD 131 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 V V T VLH +P Y++D +GI++P G+ R ++++T +A Sbjct 132 VSRVTSTGMHHATAPGRTVLHALPVGYSLDGVKGIRDPRGMVARRFGVDMNVVTSEATVA 191 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 KN++ AVERC L V+ + + + SVLT+DE +LG VV++G GT IA+Y+ G H Sbjct 192 KNLMLAVERCHLTVEAMAASPYVAGLSVLTDDEVDLGAAVVEMGAGTTTIAIYSAGRFIH 251 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG---RPP 285 G+ VT D+A G +DAE IK +G L E + VP+ G P Sbjct 252 ASGFAIGGHHVTMDLARGLGVCIADAERIKTLYGTVLTGGSDVRELMTVPAAGDSDSDAP 311 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 + + R T+A ++ R E+ +V +++L A +VL+GGA+Q+ G+ Sbjct 312 QVVSRATIANIVRQRVEEIFEMV-------RDRLADSPFAAEPRARVVLSGGASQLTGIP 364 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTAS 404 A R+ Q+RIG PL L A+ ++ GLL Y + +HL E ++V Sbjct 365 ELAGRILGRQIRIGRPLGFGRLPSEAKGASFAVPTGLLVYPQYAHLEHVEPRRTRQVRTG 424 Query 405 VGSWIKRLNSWLRKEF 420 + ++ WLR+ F Sbjct 425 TDGYFGKVGRWLREGF 440 >gi|48854568|ref|ZP_00308730.1| COG0849: Actin-like ATPase involved in cell division [Cytophaga hutchinsonii] Length=459 Score = 401 bits (1033), Expect = 3e-110, Method: Composition-based stats. Identities = 141/387 (36%), Positives = 226/387 (58%), Gaps = 11/387 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 + K+VVGL+IGT K+ A+VG G + I+G+G S G+ +G V ++ V +++ Sbjct 13 NQNDKIVVGLDIGTTKICAIVGRKNEYGKLEILGIGKAVSEGVIRGMVTNINLTVTAIEK 72 Query 64 AIDQAELMADCQISSVYLALSGKHISC-QNEIGM-VPISEEEVTQEDVENVVHTAKSVRV 121 AI +A + I V + ++G+HI + G+ P +EE++ +DV + + Sbjct 73 AIKEASDQSGIDIGVVNVGIAGQHIKSSVHHHGINRPGGDEEISVDDVNRLTADMYRTVM 132 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + ++HV+PQ Y +DY+E IK+PVG++GVR++A H+IT + + KNI + V++ L Sbjct 133 PFGNEIIHVMPQVYTVDYEENIKDPVGMTGVRLEADFHVITANTNAIKNINRCVQKGDLA 192 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 +D LI +ASS SVL+E+E+E GVC+VDIGGGT DIA++ +RHT VIP+ G+++TS Sbjct 193 IDNLILEPIASSMSVLSEEEKEAGVCLVDIGGGTTDIAIFYDNIIRHTAVIPFGGDIITS 252 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DI A+ +K++ G AL S ++ + V + RP + + + LA +I+ R Sbjct 253 DIKTGCNIMHKQADELKIKFGSALASEARANDIITVKGLRDRPAKEISAKNLASIIQCRM 312 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+L LV+ EI+ G + LA GIV+TGG AQ++ L + + RIG P Sbjct 313 EEILELVHSEIIC-------SGYEDRLAGGIVITGGGAQLQNLKQLFELMTGQHTRIGYP 365 Query 362 LNITG--LTDYAQEPYYSTAVGLLHYG 386 G T+ + P Y+TAVGL+ G Sbjct 366 NEHLGKSKTELVKSPMYATAVGLVLAG 392 >gi|20516649|gb|AAM24842.1| Gene info predicted ATPases of the HSP70 class involved in cell division [Thermoanaerobacter tengcongensis MB4] gi|20808067|ref|NP_623238.1| Gene info predicted ATPase of the HSP70 class involved in cell division [Thermoanaerobacter tengcongensis MB4] Length=408 Score = 400 bits (1030), Expect = 5e-110, Method: Composition-based stats. Identities = 138/416 (33%), Positives = 233/416 (56%), Gaps = 18/416 (4%) Query 8 KLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQ 67 L+VGL+IGT+KV ++GE G ++I+G+G PS G+ KG + D++ +Q++++Q Sbjct 3 DLIVGLDIGTSKVCTIIGEGDKTGELHIVGIGYYPSTGVKKGIIVDIDETAYSIQKSVEQ 62 Query 68 AELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRVRDEH 125 AE MA+ +ISSVYL + G + G+V +S + E+T++DVE V+ AK + + + Sbjct 63 AERMANRKISSVYLKIYGGLTTIYKNNGVVAVSREDREITRQDVERVLQAAKIIALPSDK 122 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 +++ VIP EY +D IK+PVG+SG+R++ ++T +N+ K V + GL++D + Sbjct 123 QIIDVIPLEYIVDGYGEIKDPVGMSGIRLEVNAAVVTGSVTAIQNMEKCVRKAGLEIDGI 182 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 I LA+S +VL +DE+ELGV ++D+G G DI+V+ G L ++ +I G +T+D++ Sbjct 183 IVGPLATSEAVLLKDEKELGVALIDVGAGVTDISVFKNGGLIYSSMIAVGGWHITNDLSV 242 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELL 305 +AE IK ++G + E +++ S+ G+ + +A++IE R +ELL Sbjct 243 GLKISFEEAENIKKKYGTLEKVDPDRLEPIKIASLAGKSKTTTDINEIADIIEARVSELL 302 Query 306 NLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGA-AQIEGLAACAQRVFHTQVRIGAPLNI 364 LV E +L + GV + +V+TGG + ++G AQ++F VRIG+P NI Sbjct 303 TLVYE-------RLEEAGVLEDIVTNVVITGGGISFLKGSVELAQKIFDRNVRIGSPQNI 355 Query 365 TGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 P YS VG++ Y + N T RL L++ F Sbjct 356 G-----VATPIYSAGVGVVKY---VYNNRRFMYPSTSTDKKEKKNSRLLDKLKEIF 403 >gi|46199031|ref|YP_004698.1| Gene info cell division protein ftsA [Thermus thermophilus HB27] gi|46196655|gb|AAS81071.1| Gene info cell division protein ftsA [Thermus thermophilus HB27] Length=411 Score = 400 bits (1030), Expect = 5e-110, Method: Composition-based stats. Identities = 140/417 (33%), Positives = 226/417 (54%), Gaps = 12/417 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++ GL++GT KV ++GE+ PDG+++IIG G+ PS+G+ +G V +LE + +++++ QA Sbjct 2 IIAGLDVGTTKVTTVIGELAPDGVLDIIGEGTVPSQGLRRGVVVNLERTTEAIRQSLFQA 61 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPIS-EEEVTQEDVENVVHTAKSVRVRDEHRV 127 E +A ++ V + + G H+ G+ I + + DVE + AK+ E + Sbjct 62 ERVAGVKVERVVVGVGGPHLKSVTSHGLAAIRRGHTIAEADVERAIEQAKAYPFEGELEL 121 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 LH +P E+ +D QEGI++PVG++GVR++ VHLI N+ +AVE GL +D + Sbjct 122 LHALPLEFKVDGQEGIRDPVGMAGVRLEVDVHLIAAGRGPLANLRRAVEEAGLALDAVCV 181 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 LAS +VLT +E E+ V ++DIGGGT D+AV+ GG L H+ V+P G+ VT DIA Sbjct 182 QALASGLAVLTPEEEEMTVLLLDIGGGTTDVAVFRGGRLAHSAVVPLGGDHVTHDIAQLL 241 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNL 307 P +AE +K ++G AL + + +E+ GG + LA +I PR E+L+L Sbjct 242 KIPFEEAERVKRKYGAALPELADPELVLEINQEGG-ALGEVPAPELARIIRPRMREILHL 300 Query 308 VNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGL 367 + + + L Q +VLTGG A + G A++ + VR+G P ++GL Sbjct 301 ARQSVDETLGPLEIQ------VNRVVLTGGGALLRGTDLLARQQYGLPVRVGKPQGVSGL 354 Query 368 TDYAQEPYYSTAVGLLHYGKESHLNGE----AEVEKRVTASVGSWIKRLNSWLRKEF 420 TD P ++ AVGL+ YG L + + R+ +L F Sbjct 355 TDVVASPAHAAAVGLVRYGASLPLKPQEAKRIREKPEDKPKGEGLWARIKEFLSNLF 411 >gi|88806820|ref|ZP_01122336.1| cell division protein FtsA [Robiginitalea biformata HTCC2501] gi|88783154|gb|EAR14327.1| cell division protein FtsA [Robiginitalea biformata HTCC2501] Length=443 Score = 399 bits (1028), Expect = 8e-110, Method: Composition-based stats. Identities = 128/387 (33%), Positives = 220/387 (56%), Gaps = 8/387 (2%) Query 11 VGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAEL 70 VGL+IGT K+ A++G+ G + ++G+G S G+ +G VN++ ++ +Q+A+++A+ Sbjct 8 VGLDIGTTKIVAIIGKENEYGKIEVLGIGRSKSLGVHRGVVNNITQTIQSIQQAVEEAQS 67 Query 71 MADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRDEHRVL 128 + +I +V + ++G+HI + SEE + +ED+E +V+ + + ++ Sbjct 68 DSGLKIGAVTVGIAGQHIRSLQHSDYITRANSEEVIGEEDLEKLVNQVYKLVMLPGEEII 127 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQEY +D Q IK P+G+ G R++A H++ KNI + ++ GL ++ + Sbjct 128 HVLPQEYKVDGQAEIKQPIGMYGGRLEANFHVVVGQISSIKNIGRCIKSAGLDLENITLE 187 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 188 PLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDIKEGCS 247 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 AE +K++ G A +E V +P + GR P+ + + L+++I R E++ V Sbjct 248 IIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEIIEQV 307 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-LNITGL 367 EI + + K L AGIVLTGG +Q++ L + + RIG P ++ G Sbjct 308 YLEI----KNYGHEDQKKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNEHLAGD 363 Query 368 TD-YAQEPYYSTAVGLLHYGKESHLNG 393 +D P Y+TAVGLL E+ Sbjct 364 SDTEIASPTYATAVGLLMNAVENKHRH 390 >gi|78777491|ref|YP_393806.1| Gene info Cell division protein FtsA [Thiomicrospira denitrificans ATCC 33889] gi|78498031|gb|ABB44571.1| Gene info Cell division protein FtsA [Thiomicrospira denitrificans ATCC 33889] Length=453 Score = 399 bits (1027), Expect = 1e-109, Method: Composition-based stats. Identities = 118/401 (29%), Positives = 229/401 (57%), Gaps = 13/401 (3%) Query 7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66 + V+ ++IG+ K+ A++ E+ D ++I G G C ++G+ +G + ++E K ++ A++ Sbjct 2 SRTVLAIDIGSTKICAIIAEIGSDKSISITGAGVCKAQGLKRGSITNIELASKSIRTALN 61 Query 67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTA-KSVRVRDEH 125 A+ ++ ++ + +++SG + N G+V I +EV+ +++E V+ + + + +E+ Sbjct 62 DAKRVSGTEVKNAIVSISGAYTKSLNSSGIVNIQNKEVSFKEIERVMQASLYNANIPNEY 121 Query 126 RVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQL 185 VLH +P + +D Q+ I++P+G++ R++ H++T N+ KAV G++VD + Sbjct 122 EVLHALPYNFKVDDQDYIEDPLGMNASRLEVDTHIVTTQKSNLNNLRKAVRGAGVEVDNI 181 Query 186 IFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAY 245 + AG ASS + L DE+ELGV ++D+GG T +I +++G ++R+ + + VTSD++ Sbjct 182 VLAGYASSIATLNSDEKELGVALIDMGGNTSNIVIHSGNSIRYNDFLGVGSSHVTSDLSM 241 Query 246 AFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRP-PRSLQRQTLAEVIEPRYTEL 304 A TP + AE++K+ +G L ++ +E+P +G + + + VI R E Sbjct 242 ALHTPLNVAESVKLTYGSLLAPS---NDLIELPIIGNESATHEVSLEVVHNVIYARVEE- 297 Query 305 LNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFH-TQVRIGAPLN 363 ++ L + + G+K + AG+VLTGG +Q+EG+ A F VR+ P Sbjct 298 ------TLMILAQFIENSGLKDKMGAGVVLTGGFSQMEGIRELAIATFGSVPVRLAKPKE 351 Query 364 ITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 + GL D + P YS+A+GL+ Y ++ E +V +RV S Sbjct 352 MHGLFDNLRSPEYSSAIGLVIYAASAYTLYEIDVNRRVRHS 392 >gi|68196302|gb|EAN10731.1| Cell division protein FtsA [Enterococcus faecium DO] gi|69244711|ref|ZP_00602975.1| Cell division protein FtsA [Enterococcus faecium DO] Length=441 Score = 399 bits (1027), Expect = 1e-109, Method: Composition-based stats. Identities = 124/387 (32%), Positives = 204/387 (52%), Gaps = 16/387 (4%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 + VGL+IGT V +V E + D +NIIGVG+ S G+++G + D++ V+ +QR Sbjct 1 MAKTGMYVGLDIGTTSVKVVVAEYI-DSQMNIIGVGNAKSEGINRGIIVDIDKTVQAIQR 59 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISE--EEVTQEDVENVVHTAKSVRV 121 A+ QAE A QI V + L + +N GM+ ++ +E+T EDV NV A + Sbjct 60 AVRQAEEKAGIQIKGVSVGLPANMLEVENCQGMIAVNGDSKEITDEDVRNVASAALVRSI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 E +++ ++PQ++ +D EGIK+P G+ GVR++ L T + NI K VE GL Sbjct 120 PPERQIVSILPQDFTVDGFEGIKDPRGMIGVRLEMYGLLFTGPKTIIHNIRKCVENAGLI 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V++++ LA + S+L++ E++ G V+D+GGG AV L+ T + G VT Sbjct 180 VNEMVITPLALTESILSDGEKDFGTIVIDMGGGQTTTAVMHDKQLKFTNLDQEGGEFVTK 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DI+ T ++AEA+K+ +G A DE V +G P + + L+E+I R Sbjct 240 DISIVLNTSFNNAEALKINYGDAYPERTSPDEEFPVDVIGQSEPVKVDERYLSEIISARM 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 ++ N + + Q++ L G+VLTGGAA + G+ AQ +F V++ P Sbjct 300 EQIFNKAKDALDQIEAL--------ELPGGVVLTGGAASLPGVVDLAQEIFGVNVKLYVP 351 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKE 388 N GL + P ++ + ++ Y Sbjct 352 -NHMGL----RNPVFTNVISIVDYSAN 373 >gi|78170241|gb|ABB27337.1| Gene info Cell division protein FtsA [Chlorobium chlorochromatii CaD3] gi|78188042|ref|YP_378380.1| Gene info Cell division protein FtsA [Chlorobium chlorochromatii CaD3] Length=435 Score = 399 bits (1026), Expect = 2e-109, Method: Composition-based stats. Identities = 128/393 (32%), Positives = 221/393 (56%), Gaps = 11/393 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 + VGL+IGT KV +V E G +N++G G S G+ + V ++ V ++ Sbjct 1 MLKSNIAVGLDIGTTKVCVVVAEKDESGKLNVLGKGRSNSDGLQRATVVNINKTVASIKA 60 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV-TQEDVENVVHTAKSVR-- 120 A+ AE + +I V + +SG H+ C + + I++ + + DV + AK+ Sbjct 61 AVADAERESSIRIRGVNVGISGAHVHCIHSNSEISINQTGIVNESDVRRFLEKAKTNIRY 120 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +H ++HVIPQE+ +D QEG+ +P+G++G M+ +++ +NI + VE+ GL Sbjct 121 LDIDHEIIHVIPQEFIVDDQEGLLDPIGMAGTTMRGSAYIVVGLKTKIRNIRQCVEKAGL 180 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 ++ + F +AS +V+ E E++ GV V+DIGGGT ++A+Y GA+R+++VI AGN VT Sbjct 181 EISAITFEPVASGMAVMKEREKKSGVVVIDIGGGTTEVALYIDGAIRYSEVIKVAGNDVT 240 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 DIA+ AE +K++HGCA ++G DE + + + GRP +S+ + +L +IE R Sbjct 241 HDIAHGIRALYEVAEDLKIKHGCAHSKLMGDDEELLIEGIEGRPQKSVPKSSLTMIIEAR 300 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+L LV + I ++ G +L AG ++TGG + + G A V VR G Sbjct 301 MLEILELVRDSI-------KRSGYYEYLNAGAIITGGGSLLPGTEELAHEVLGLDVRKGT 353 Query 361 PLNI-TGLTDYAQEPYYSTAVGLLHYGKESHLN 392 P + G+ + P Y+T +GL+ + E++L+ Sbjct 354 PEGVSGGIKEAVNNPMYATVMGLVAHSFENNLS 386 >gi|56677833|gb|AAV94499.1| Gene info cell division protein FtsA [Silicibacter pomeroyi DSS-3] gi|56696096|ref|YP_166450.1| Gene info cell division protein FtsA [Silicibacter pomeroyi DSS-3] Length=445 Score = 397 bits (1023), Expect = 3e-109, Method: Composition-based stats. Identities = 114/436 (26%), Positives = 198/436 (45%), Gaps = 26/436 (5%) Query 3 KATDRKLVVGLEIGTAKVAALVGEVLPDGM---------------VNIIGVGSCPSRGMD 47 +A R +V L++G++K++ L+ G +IG + SRG+ Sbjct 18 QAIQRGVVAILDVGSSKISCLILRFDGSGRLSEDSAIGSMAGQTGFRVIGAATTRSRGVQ 77 Query 48 KGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQE 107 G + ++ + ++ A+ A+ MAD ++ V SG + V + + VT+ Sbjct 78 FGEITAMQETERAIRTALQAAQKMADIRVDHVIACFSGANPRSYGLDAKVELETQVVTES 137 Query 108 DVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDM 167 ++ V++ + VLH P +A+D + G+ +P G G + +H++T Sbjct 138 EIGRVLNACEVPEYGAGREVLHAQPVNFALDNRSGLIDPRGQLGQSLAVDMHMLTVDATA 197 Query 168 AKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALR 227 +N+ ++RC L++ + + S S L EDE+ELG +D+GGGT I+++ + Sbjct 198 IRNLAHCIKRCDLELAGVANSAYVSGVSALVEDEQELGAACIDMGGGTTSISIFLKKHMI 257 Query 228 HTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---P 284 + G+ VT DI+ G P ++AE IK G + E ++V G Sbjct 258 FADCVRMGGDHVTGDISMGLGVPTANAERIKTFSGGVHATGADDREMIDVGGDTGDWEHD 317 Query 285 PRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGL 344 R++ R L ++ PR E+L V + +L G +H + IVLTGG +QI GL Sbjct 318 RRTVSRAELIGIMRPRVEEILEEV-------RARLDAAGFEHLPSQQIVLTGGGSQIMGL 370 Query 345 AACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTAS 404 A R+ +VR+G PL + GL A P +S+AVGL + + E V Sbjct 371 DGLASRILGQRVRLGRPLRVHGLPQSATGPGFSSAVGLSLFAAHPQDEW-WDFEVPVDRY 429 Query 405 VGSWIKRLNSWLRKEF 420 ++R W R + Sbjct 430 PARSLRRAVKWFRDNW 445 >gi|55772470|dbj|BAD70911.1| Gene info cell division protein FtsA [Thermus thermophilus HB8] gi|55981057|ref|YP_144354.1| Gene info cell division protein FtsA [Thermus thermophilus HB8] Length=411 Score = 397 bits (1023), Expect = 4e-109, Method: Composition-based stats. Identities = 142/417 (34%), Positives = 227/417 (54%), Gaps = 12/417 (2%) Query 9 LVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQA 68 ++ GL++GT KV ++GE+ PDG+++IIG G+ PS+G+ +G V +LE + +++++ QA Sbjct 2 IIAGLDVGTTKVTTVIGELAPDGVLDIIGEGTVPSQGLRRGVVVNLERTTEAIRQSLFQA 61 Query 69 ELMADCQISSVYLALSGKHISCQNEIGMVPIS-EEEVTQEDVENVVHTAKSVRVRDEHRV 127 E +A ++ V + + G H+ G+ I + + DVE + AK+ E + Sbjct 62 ERVAGVKVERVVVGVGGPHLKSVTSHGLAAIRRGHTIAEADVERAIEQAKAYPFEGELEL 121 Query 128 LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIF 187 LH +P E+ +D QEGI++PVG++GVR++ VHLI N+ +AVE GL +D + Sbjct 122 LHALPLEFKVDGQEGIRDPVGMAGVRLEVDVHLIAAGRGPLANLRRAVEEAGLALDAVCV 181 Query 188 AGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAF 247 LAS +VLT +E E+ V ++DIGGGT D+AV+ GG L H+ V+P G+ VT DIA Sbjct 182 QALASGLAVLTPEEEEMTVLLLDIGGGTTDVAVFRGGRLAHSAVVPLGGDHVTHDIAQLL 241 Query 248 GTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNL 307 P +AE +K ++G AL + + +E+ GG + LA +I PR E+L+L Sbjct 242 KIPFEEAERVKRKYGAALPELADPELVLEINQEGG-ALGEVPAPELARIIRPRMREILHL 300 Query 308 VNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGL 367 + + + L Q +VLTGG A + G A++ + VR+G P ++GL Sbjct 301 ARQSVDETLGPLEIQ------VNRVVLTGGGALLRGTDLLARQQYGLPVRVGKPQGVSGL 354 Query 368 TDYAQEPYYSTAVGLLHYGKE---SHLNGEAEVEKRVTASVG-SWIKRLNSWLRKEF 420 TD P ++ AVGL+ Y L + EK G R+ +L F Sbjct 355 TDVVASPAHAAAVGLVRYRASLPLKPLEAKRIREKPEDKPKGEGLWARIKEFLSNLF 411 >gi|77996717|gb|ABB15616.1| Gene info cell division protein FtsA [Carboxydothermus hydrogenoformans Z-2901] gi|78044602|ref|YP_360880.1| Gene info cell division protein FtsA [Carboxydothermus hydrogenoformans Z-2901] Length=410 Score = 397 bits (1023), Expect = 4e-109, Method: Composition-based stats. Identities = 134/419 (31%), Positives = 231/419 (55%), Gaps = 11/419 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 ++L+ +++G++K+ AL+GE+ DG V ++GVG S G+ KG + D++ VK ++ Sbjct 1 MAKKELIAVVDVGSSKIVALIGEIAADGQVTLLGVGETASSGIKKGAIVDIDGTVKAIKT 60 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPIS--EEEVTQEDVENVVHTAKSVRV 121 ++++AE + ++S ++ + + N +V ++ E E+T EDV V++ K V + Sbjct 61 SLEKAEQIVGYGLTSAVVSFTSPSLISLNNKSVVAVTNLEREITSEDVNRVLNATKIVPI 120 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 + +++ IP+ Y +D G+ +PVG++G R++A+ H+I N+ K + GL Sbjct 121 PPDKKIIKAIPRFYTVDGFAGVVDPVGMTGSRLEAETHIIAVAQSTFANLQKVASKAGLN 180 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V + I A LAS+ VL E+ELG ++DIG GTMD+A+Y+ G+L T IP +T+ Sbjct 181 VLEFIPAILASAEVVLYPAEKELGCLLIDIGAGTMDLAIYSEGSLFFTGAIPVGDQYITN 240 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 D+A TP + AE IK+ G AL S+V DE +EV +VGG + + +Q +A +IE R Sbjct 241 DLAIGLRTPIAVAEKIKIEAGTALASLVQNDEYLEVENVGGTEKQKVSKQMVAAIIEARV 300 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 E+L L +EI R G L G+++TGG A + G+ AQ +F VRIG P Sbjct 301 REMLELALKEI-------RSSGFTGLLPGGVIITGGGAMLPGIKEVAQEIFDLPVRIGVP 353 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420 ++ L P Y++A+G L + + E E + +++ ++ + F Sbjct 354 EGLSNLPVNLINPRYASAIGALVLAAKQY--REEPEESSGIDFLSGIFQKIKAFFSELF 410 >gi|21645923|gb|AAM71279.1| Gene info cell division protein FtsA [Chlorobium tepidum TLS] gi|21672872|ref|NP_660937.1| Gene info cell division protein FtsA [Chlorobium tepidum TLS] Length=447 Score = 397 bits (1021), Expect = 6e-109, Method: Composition-based stats. Identities = 127/392 (32%), Positives = 220/392 (56%), Gaps = 11/392 (2%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 +VVGL+IGT KV +V E G +N++G G S G+ + V ++ V +++ Sbjct 7 MPKSNIVVGLDIGTTKVCVVVAEKDDVGKLNVLGKGRANSEGLQRATVVNINKTVDAIRK 66 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV-TQEDVENVVHTAKSVR-- 120 A+ AE + +I V + +SG H+ C + +++ + + DV + AK+ Sbjct 67 AVADAERESSIKIKGVNVGISGAHVHCIYSNSEISVNQSGIVNESDVRRFLEKAKTNIRY 126 Query 121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180 + +H ++HVIPQE+ +D Q+G+ +P+G++G M+ +++ +NI + +E+ GL Sbjct 127 LDIDHEIIHVIPQEFIVDDQDGVLDPIGMAGTIMRGSAYIVVGLRTKIRNIKQCIEKAGL 186 Query 181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240 +V + F +AS +V+ E ER GV V+DIGGGT ++A+Y GA+R+++VI A N VT Sbjct 187 EVSAMTFEPVASGLAVMKESERRSGVVVIDIGGGTTEVAIYIDGAIRYSEVIKVAANDVT 246 Query 241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300 D+AY AE IK++HGCA ++ K+E + + S+ GRP +S + +L +IE R Sbjct 247 HDVAYGIKALNDVAEEIKIQHGCAYAKVLDKEEEILIESIEGRPSKSFPKSSLTVIIEAR 306 Query 301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360 E+ LV + I ++ G +L AG+++TGG A + G A+ + VR G Sbjct 307 MMEIFELVRDII-------KRSGYYDYLNAGVIITGGGALLPGTGELARDILGLDVRTGY 359 Query 361 PLNI-TGLTDYAQEPYYSTAVGLLHYGKESHL 391 P + G+ D P Y+T +GL+ + +++L Sbjct 360 PEGVSGGIKDAINNPMYATVMGLVAHSLQNNL 391 >gi|39650441|emb|CAE28964.1| Gene info putative cell division protein FtsA [Rhodopseudomonas palustris CGA009] gi|39936585|ref|NP_948861.1| Gene info putative cell division protein FtsA [Rhodopseudomonas palustris CGA009] Length=440 Score = 396 bits (1020), Expect = 7e-109, Method: Composition-based stats. Identities = 123/426 (28%), Positives = 210/426 (49%), Gaps = 21/426 (4%) Query 9 LVVGLEIGTAKVAALVGEVLP----------DGMVNIIGVGSCPSRGMDKGGVNDLESVV 58 +V L+IGT+K+A ++ + P + ++G SRG+ G V D+ Sbjct 22 MVASLDIGTSKIACMIARLKPCPPQEALRGRTHSIELVGYSQIQSRGVKAGAVVDMAECE 81 Query 59 KCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKS 118 K ++ A+ AE MA ++ SV L++S + Q I VT ED+ V T Sbjct 82 KAIRHAVALAERMAKVRVESVLLSVSAGRLQGQLIEATSDIKGGAVTAEDISRVTSTGMH 141 Query 119 VRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERC 178 VLH +P Y +D +GI++P G+ + ++++T +AKN++ AVERC Sbjct 142 HATGIGRAVLHALPVGYTLDGVKGIRDPRGMVARQFGVDMNVVTTDATVAKNLMLAVERC 201 Query 179 GLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNV 238 L+V+ + + + S+LT+DE +LG ++++G GT +A+Y+GG H G+ Sbjct 202 HLEVEAMAASPYVAGLSMLTDDEVDLGAALIEMGAGTTTLAIYSGGRFVHASGFAVGGHH 261 Query 239 VTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGG--RPPRSLQRQTLAEV 296 +T D+A G +DAE IK +G L E + +P+ G P+ + R T+A + Sbjct 262 ITMDLARGLGACIADAERIKTLYGTVLTGGSDARELMSIPAAGDERDNPQVISRATIANI 321 Query 297 IEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQV 356 I R E+ +V +++L + A +VL+GGA+Q+ G+ A R+ V Sbjct 322 IRHRAEEIFEMV-------RDRLAESPFAAEPRARVVLSGGASQLTGVPELATRILGRSV 374 Query 357 RIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNG-EAEVEKRVTASV-GSWIKRLNS 414 R+G PL I L + A+ ++ GLL Y + +HL E + + A + ++ Sbjct 375 RVGRPLGIGRLPNEAKSGSFAVPTGLLVYPQFAHLEHIEPRHTRHIRADAHAGYFGKVGR 434 Query 415 WLRKEF 420 WLR+ F Sbjct 435 WLREGF 440 >gi|89055242|ref|YP_510693.1| Gene info cell division protein FtsA [Jannaschia sp. CCS1] gi|88864791|gb|ABD55668.1| Gene info cell division protein FtsA [Jannaschia sp. CCS1] Length=444 Score = 396 bits (1019), Expect = 9e-109, Method: Composition-based stats. Identities = 114/440 (25%), Positives = 195/440 (44%), Gaps = 32/440 (7%) Query 2 IKATDRKLVVGLEIGTAKVAALV---------------GEVLPDGMVNIIGVGSCPSRGM 46 +A R ++ L+IGT KVA LV G + +IG + SRG+ Sbjct 16 TEAMRRGVIAVLDIGTFKVACLVLRFDGADLSMEDDGIGAMAGQSSFRVIGAATTRSRGV 75 Query 47 DKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQ 106 G ++ + + ++ A+ A+ MA ++ V ++L+G G V + V Sbjct 76 KFGEIDTVHETERAIRTAVQAAQKMAGARVDHVIVSLAGACPRSYGLTGEVDLQTGAVED 135 Query 107 EDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHND 166 D+ V+ + E VLH P +++D + G+ +P G G R+ +HL+T + Sbjct 136 HDIGRVLSVCDMPDIGSERDVLHAQPVNFSLDNRTGLSDPRGHVGNRLSCDMHLLTVDSH 195 Query 167 MAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGAL 226 + ++ V+RC L++ + A ++ S L EDE+ELG +D+G G ++++ + Sbjct 196 AIETLLHCVKRCDLELAGVASAPYVAAMSSLVEDEQELGAACIDLGAGATSLSIFMKKHM 255 Query 227 RHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPP- 285 + G +T DI+ P AE IK + G + + + E +E+ S G Sbjct 256 IFADTVRLGGAHITRDISQGLHIPVDKAERIKTKFGGLMATGLDDREIIELDSDTGDWHH 315 Query 286 --RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEG 343 R++ R L V+ PR E+L ++ +L G +H + IVLTGG +QI G Sbjct 316 DRRTVSRAELIGVMRPRVEEILE-------DVRARLDAAGFEHLPSQRIVLTGGGSQIPG 368 Query 344 LAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKR 400 L A R+ QVR+G P+ + GL A +S VGL + + ++ Sbjct 369 LDGLASRILGNQVRLGRPMRVAGLPQSAYGSAFSACVGLALFAASPQDEWWDFDLPADRL 428 Query 401 VTASVGSWIKRLNSWLRKEF 420 SV R W R + Sbjct 429 PVRSVR----RAVKWFRDNW 444 >gi|28271635|emb|CAD64541.1| Gene info cell division protein FtsA [Lactobacillus plantarum WCFS1] gi|28378798|ref|NP_785690.1| Gene info cell division protein FtsA [Lactobacillus plantarum WCFS1] Length=448 Score = 395 bits (1018), Expect = 1e-108, Method: Composition-based stats. Identities = 124/384 (32%), Positives = 200/384 (52%), Gaps = 16/384 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + + VGL+IGT + +V E + G +N+IGVGS S G+ +G + D++ + ++ A+ Sbjct 3 NSGIYVGLDIGTTSIKVIVAERVK-GQMNVIGVGSARSNGLSRGVIVDIDKAAETIRSAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISEE--EVTQEDVENVVHTAKSVRVRD 123 QAE A +I V + + + GM+ +++E E+ EDV+NV A + Sbjct 62 RQAEEKASIEIKKVIAGVPANLVKIERCRGMIAVADESKEINNEDVQNVAAAALVQSLPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E VL VIP E+ +D +GIK+P G+ GVR++ L T + N KA+E+ GL+++ Sbjct 122 EREVLDVIPDEFVVDGFDGIKDPRGMVGVRLEMHGTLFTGPKTIIHNTRKALEKAGLQIE 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 Q++ A LA S VL + E++ G ++D+GGG AV L++T V G +T DI Sbjct 182 QIVIAPLALSSLVLNDGEQDFGSIIIDMGGGQTTAAVIHDHQLKYTYVDQEGGQYITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE +K +G A DE V VG P + Q LAE+IE R + Sbjct 242 SVVLNTSIENAEKLKRDYGYADAQQASDDELFPVDVVGQSTPEQISEQYLAEIIEARLDQ 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + + V + + +++ L GIVLTGG A + G+ A + F T+VR+ P N Sbjct 302 IFDKVKQHLDEIRAL--------ELPGGIVLTGGVAALPGITDLAAQRFGTRVRVFTP-N 352 Query 364 ITGLTDYAQEPYYSTAVGLLHYGK 387 GL + P + A+ ++ Y Sbjct 353 QMGL----RHPSFDEALAVIKYQA 372 >gi|73659908|emb|CAI82515.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] gi|73748192|ref|YP_307431.1| Gene info cell division protein FtsA [Dehalococcoides sp. CBDB1] Length=408 Score = 395 bits (1018), Expect = 1e-108, Method: Composition-based stats. Identities = 138/416 (33%), Positives = 237/416 (56%), Gaps = 18/416 (4%) Query 5 TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRA 64 ++V +++GT K+ ++ EV P G VN++GVG PS+G+ KG V ++ + ++ + Sbjct 1 MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKGLVVNINDARESIRES 60 Query 65 IDQAELMADCQISSVYLALSGKHISCQNEIGMVPI--SEEEVTQEDVENVVHTAKSVRVR 122 I +AE + ++ S Y+ ++G+H++ N G+V I ++ V +D++ V+ TA+++ V Sbjct 61 IRKAEQASGYKVESAYVGVTGRHVTSMNNKGVVAITRNDRLVRSDDLKRVMATAQNISVP 120 Query 123 DEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKV 182 ++ ++LHVIP+ YA+D Q G+KNPVG+ G R+ + H+IT +N+VK + G+ + Sbjct 121 NDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAATSVQNLVKCIRGLGIDI 180 Query 183 DQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSD 242 D L+ +ASS +VLT+DE+++GV + DIGGGT DI V+ G++ HT +IP AG +T D Sbjct 181 DDLVLEPIASSEAVLTDDEKQVGVILADIGGGTTDICVFKDGSIWHTAIIPVAGYQLTRD 240 Query 243 IAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYT 302 +A G P AE +K R+G L + +E PS + Q L ++I R Sbjct 241 VAIGLGLPFDVAEEMKKRYGSVLPVY---ETKMESPSPICEDGHGVSYQDLCDIIRARVE 297 Query 303 ELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPL 362 E+L L+ EI + AG+VLTGG++ + G+ + + VR+G P Sbjct 298 EVLRLIMLEI-------PNSDYDSLVPAGLVLTGGSSNLAGMETLGRDILRIPVRVGNPD 350 Query 363 NITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418 + G+ D +P Y+T VGLL +G + V+K ++G + R+ + L+ Sbjct 351 KVYGIVDSLHDPAYATGVGLLLWGAKHQ-----PVKKSWLDNIG-FFGRMRNLLKG 400 >gi|2222676|emb|CAA74237.1| ftsA [Enterococcus hirae] gi|3122103|sp|O07672|FTSA_ENTHR Cell division protein ftsA Length=442 Score = 395 bits (1017), Expect = 2e-108, Method: Composition-based stats. Identities = 126/387 (32%), Positives = 204/387 (52%), Gaps = 16/387 (4%) Query 4 ATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQR 63 + VGL+IGT V +V E + D +NIIGVG+ S G+++G + D++ V+ +QR Sbjct 1 MAKTGMYVGLDIGTTSVKVVVAEYI-DSQMNIIGVGNAKSEGINRGIIVDIDKTVQAIQR 59 Query 64 AIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISE--EEVTQEDVENVVHTAKSVRV 121 A+ QAE A QI V + L + +N GM+ ++ +E+T EDV NV A + Sbjct 60 AVRQAEEKAGIQIKGVSVGLPANLLEVENCQGMIAVNGDSKEITDEDVRNVASAALVRSI 119 Query 122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181 E +++ ++PQ++ +D EGIK+P G+ GVR++ L T + NI K VE GL Sbjct 120 PPERQIVSILPQDFTVDGFEGIKDPRGMIGVRLEMYGLLFTGPKTIVHNIRKCVENAGLV 179 Query 182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241 V++L+ LA + ++L++ E++ G V+D+GGG AV L+ T + G VT Sbjct 180 VNELVITPLALTETILSDGEKDFGTIVIDMGGGQTTTAVMHDKQLKFTSLDQEGGEFVTK 239 Query 242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301 DI+ T ++AEA+K+ +G A +E V +G P + + L+EVI R Sbjct 240 DISIVLNTSFNNAEALKINYGDAYPERTSANEEFPVDVIGQSEPVKVDERYLSEVISARM 299 Query 302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361 ++ N E + Q++ L GIVLTGGAA + G+ AQ +F V++ P Sbjct 300 EQIFNKAKEALDQIEAL--------ELPGGIVLTGGAASLPGVVDLAQEIFGVNVKLYVP 351 Query 362 LNITGLTDYAQEPYYSTAVGLLHYGKE 388 N GL + P ++ + ++ Y Sbjct 352 -NQMGL----RNPVFTNVISIVDYSAN 373 >gi|83856722|ref|ZP_00950251.1| Cell division protein FtsA [Croceibacter atlanticus HTCC2559] gi|83850522|gb|EAP88390.1| Cell division protein FtsA [Croceibacter atlanticus HTCC2559] Length=445 Score = 395 bits (1017), Expect = 2e-108, Method: Composition-based stats. Identities = 124/401 (30%), Positives = 217/401 (54%), Gaps = 8/401 (1%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + VGL+IGT K+ A++G+ G + I+G+G S G+ +G VN++ ++ +Q+A+ Sbjct 3 KDNIAVGLDIGTTKIVAMIGKHNEYGKLEILGIGRSKSLGVHRGVVNNITQTIQSIQQAV 62 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMV--PISEEEVTQEDVENVVHTAKSVRVRD 123 D+A+ + +I V + ++G+HI + P ++E + +D+E + + + Sbjct 63 DEAQADSGLKIEDVVVGIAGQHIRSLQHSDYITRPNADEVIDSKDIEKLCGQVHKLVMLP 122 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 ++HV+PQE+ ID Q +K P+G+ G R++A H++ +NI + V+ GL++ Sbjct 123 GEEIIHVLPQEFKIDGQAEVKEPIGMYGGRLEANFHVVVGQVASIRNIGRCVKSSGLELS 182 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 + LAS+ +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ GNV+T DI Sbjct 183 TVTLEPLASANAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGNVITEDI 242 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 AE +K++ G A +E V +P + GR P+ + + L+++I R E Sbjct 243 KEGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVE 302 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 ++ EI + + K L AGIVLTGG AQ++ L + + RIG P Sbjct 303 IIEQAYLEIKNYGHEEQ----KKKLIAGIVLTGGGAQLKHLKQLVEYITGMDTRIGFPNE 358 Query 364 ITGLTDYAQ--EPYYSTAVGLLHYGKESHLNGEAEVEKRVT 402 + + P Y+TAVGL+ E + ++ V Sbjct 359 HLAHDNEKELTSPQYATAVGLVMNSLEENKKKPLVAKEEVV 399 >gi|88713167|ref|ZP_01107251.1| cell division protein FtsA [Flavobacteriales bacterium HTCC2170] gi|88708548|gb|EAR00784.1| cell division protein FtsA [Flavobacteriales bacterium HTCC2170] Length=440 Score = 395 bits (1016), Expect = 2e-108, Method: Composition-based stats. Identities = 127/395 (32%), Positives = 223/395 (56%), Gaps = 8/395 (2%) Query 11 VGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAEL 70 VGL+IGT K+ A++G+ G + I+G+G S G+ +G VN++ ++ +Q+A+++AE+ Sbjct 8 VGLDIGTTKIVAIIGKENEYGKIEILGIGRSKSLGVHRGVVNNITQTIQSIQQAVEEAEV 67 Query 71 MADCQISSVYLALSGKHISCQNEIGMVPISEEE--VTQEDVENVVHTAKSVRVRDEHRVL 128 + +I SV + ++G+HI + ++ E + ++D++ + + + + ++ Sbjct 68 NSGLKIGSVVVGIAGQHIRSLQHSDYITRADAEEVINEDDLDRLCNQVYKLVMLPGEEII 127 Query 129 HVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFA 188 HV+PQEY +D Q IK P+G+ G R++A H++ KN+ + ++ GL + ++ Sbjct 128 HVLPQEYKVDGQAEIKEPIGMYGGRLEANFHVVVGQVSSIKNVGRCIKSAGLDLGKITLE 187 Query 189 GLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFG 248 LASS +VL+++E+E GV ++DIGGGT D+A++ G +RHT VIP+ G V+T DI Sbjct 188 PLASSDAVLSQEEKEAGVALIDIGGGTTDLAIFKDGIIRHTAVIPFGGGVITEDIKEGCS 247 Query 249 TPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLV 308 AE +K++ G A +E V +P + GR P+ + + L+++I R E++ V Sbjct 248 IIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRGREPKEITLKNLSKIIHARVVEIIEQV 307 Query 309 NEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP-LNITGL 367 EI + + K L AGIVLTGG +Q++ L + + RIG P ++ G Sbjct 308 YVEIKNYGHEEQ----KKKLIAGIVLTGGGSQLKHLKQLVEYITGMDTRIGYPNEHLAGD 363 Query 368 TDY-AQEPYYSTAVGLLHYGKESHLNGEAEVEKRV 401 TD P Y+TAVGLL +++ E+ V Sbjct 364 TDEAVASPLYATAVGLLMNAVKNNGMDIISHEEEV 398 >gi|84686346|ref|ZP_01014240.1| cell division protein FtsA [Rhodobacterales bacterium HTCC2654] gi|84665529|gb|EAQ12005.1| cell division protein FtsA [Rhodobacterales bacterium HTCC2654] Length=444 Score = 394 bits (1015), Expect = 3e-108, Method: Composition-based stats. Identities = 114/438 (26%), Positives = 203/438 (46%), Gaps = 32/438 (7%) Query 4 ATDRKLVVGLEIGTAKVAALV---------------GEVLPDGMVNIIGVGSCPSRGMDK 48 A R ++ L+IGT+K+ LV G + +IG + SRG+ Sbjct 18 AMQRGVIAILDIGTSKIGCLVLRFDGNDRVAANDGVGSLAGQSGFRVIGAATTRSRGVRF 77 Query 49 GGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQED 108 G ++ ++ + ++ AI A+ MA+ ++ V + SG + G V ++ VT++D Sbjct 78 GEIDAMQETERAIRTAIQAAQKMANMRVDHVIVTFSGANPRSYGVAGEVDVAGTAVTEDD 137 Query 109 VENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMA 168 + V+ + + V+H P +A+D++ G+ +P G + +HL+T Sbjct 138 IARVMASCDVPDFGEGREVIHAQPVNFALDHRSGLSDPREQVGKTLAVDMHLLTIDAATV 197 Query 169 KNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRH 228 +N+ ++RC L++ L + + + L EDE+ELG +D+GGG+ ++++ + + Sbjct 198 RNVAYCIKRCDLELAGLASSSYTAGLASLVEDEQELGAACIDMGGGSTGVSIFMKKHMIY 257 Query 229 TKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGR---PP 285 + G+ VTSDI+ P + AE IK +G + + E +E+ G Sbjct 258 ADSVRLGGDHVTSDISKGLQIPMATAERIKTFYGGVFATGMDDREMIEIGGDTGDWEHDR 317 Query 286 RSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLA 345 R++ R L +++PR E+L V + +L G H + IVLTGGA+QI GL Sbjct 318 RTVSRSELIGIMKPRVEEILEEV-------RARLDAAGFDHLPSQQIVLTGGASQIPGLD 370 Query 346 ACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLN---GEAEVEKRVT 402 A R+ QVRIG PL + GL A +++AVGL + + E Sbjct 371 TLAPRILGQQVRIGRPLRVQGLPQAATGAAFASAVGLCLFAASPQDEWWDFDIPAESYPA 430 Query 403 ASVGSWIKRLNSWLRKEF 420 S+ +K W + + Sbjct 431 RSLRWAVK----WFKDNW 444 >gi|81428364|ref|YP_395364.1| Gene info Cell division protein, FtsA [Lactobacillus sakei subsp. sakei 23K] gi|78610006|emb|CAI55054.1| Gene info Cell division protein, FtsA [Lactobacillus sakei subsp. sakei 23K] Length=436 Score = 394 bits (1015), Expect = 3e-108, Method: Composition-based stats. Identities = 109/382 (28%), Positives = 200/382 (52%), Gaps = 16/382 (4%) Query 6 DRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAI 65 + K+ VGL++GT + +V E + + +N+IGVGS S G+ +G + D++ V +Q+A+ Sbjct 3 NSKIYVGLDVGTTSIKVIVAESM-NKQLNVIGVGSARSNGLSRGTIVDIDQAVSAIQQAV 61 Query 66 DQAELMADCQISSVYLALSGKHISCQNEIGMVPISE--EEVTQEDVENVVHTAKSVRVRD 123 QAE A+ +I+ V + + + GM+ +S+ +E+T +DV++V A + Sbjct 62 QQAEQKANIEITQVVAGIPANLLQIEECQGMIAVSDQSKEITSQDVQDVASAALVRNLPP 121 Query 124 EHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVD 183 E +L V+P ++ +D +GIK+P G+ GVR++ L T M N+ K +E+ GL++ Sbjct 122 EREILTVLPMQFTVDGFDGIKDPRGMMGVRLEMSGILFTAPKTMIHNLKKCIEKAGLELS 181 Query 184 QLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDI 243 QL+ LA L++ E++ G +VD+GGG AV L+ T + G+ +T DI Sbjct 182 QLVVNPLALGKLALSDGEQDFGAIIVDLGGGQSTAAVIHDHQLKFTAIDQEGGDHITKDI 241 Query 244 AYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTE 303 + T +AE K +G A + ++E + + VG P + + LAE+IE R + Sbjct 242 SVVLNTSIENAEKAKRDYGNADSLVASEEEQIPIEVVGQTAPIQITEKKLAEIIEARMMQ 301 Query 304 LLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLN 363 + + + + ++ + GIV+TGG + G+ AQ VF+ V++ P Sbjct 302 IFDRLKTALDKVNA--------FDMPGGIVMTGGVTALPGIVDLAQEVFNCPVKLYIPDQ 353 Query 364 ITGLTDYAQEPYYSTAVGLLHY 385 + + P ++ + L++Y Sbjct 354 MG-----LRHPSFAQGLSLINY 370 >