spacer

WU-Blast2 Results


SUBMISSION PARAMETERS
Title Sequence Database uniprot
Sequence length 420 Sequence type p
Program WU-blastp Version 2.0MP-WashU [04-May-2006]
Matrix BLOSUM62 Number of scores 50
Number of alignments 50 Expected threshold 10
Filter none View filter yes

BLASTP 2.0MP-WashU [04-May-2006] [linux26-x64-I32LPF64 2006-05-10T17:22:28]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  Sequence
        (420 letters)
>Unfiltered+0
MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF

Database:  uniprot
           4,739,517 sequences; 1,558,448,118 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

Pairwise Alignment 1 UNIPROT:FTSA_ECO57 P0ABH2 Cell division protein ftsA.         2140  1.6e-220  1
Pairwise Alignment 2 UNIPROT:FTSA_ECOL6 P0ABH1 Cell division protein ftsA.         2140  1.6e-220  1
Pairwise Alignment 3 UNIPROT:FTSA_ECOLI P0ABH0 Cell division protein ftsA.         2140  1.6e-220  1
Pairwise Alignment 4 UNIPROT:FTSA_SHIFL P0ABH3 Cell division protein ftsA.         2140  1.6e-220  1
Pairwise Alignment 5 UNIPROT:Q0TLP5_ECOL5 Q0TLP5 Cell division protein FtsA.       2140  1.6e-220  1
Pairwise Alignment 6 UNIPROT:A2ULK6_ECOLI A2ULK6 Cell division protein FtsA.       2140  1.6e-220  1
Pairwise Alignment 7 UNIPROT:Q1RGA1_ECOUT Q1RGA1 ATP-binding cell division pro...  2140  1.6e-220  1
Pairwise Alignment 8 UNIPROT:Q32JZ8_SHIDS Q32JZ8 ATP-binding cell division pro...  2140  1.6e-220  1
Pairwise Alignment 9 UNIPROT:Q3Z5R5_SHISS Q3Z5R5 ATP-binding cell division pro...  2140  1.6e-220  1
Pairwise Alignment 10 UNIPROT:A1A7D9_ECOK1 A1A7D9 Cell division protein.            2140  1.6e-220  1
Pairwise Alignment 11 UNIPROT:Q326E1_SHIBS Q326E1 ATP-binding cell division pro...  2140  1.6e-220  1
Pairwise Alignment 12 UNIPROT:Q5PDD3_SALPA Q5PDD3 Cell division protein FtsA.       2133  8.9e-220  1
Pairwise Alignment 13 UNIPROT:Q57TC6_SALCH Q57TC6 ATP-binding cell division pro...  2133  8.9e-220  1
Pairwise Alignment 14 UNIPROT:Q7CR80_SALTY Q7CR80 ATP-binding cell division pro...  2133  8.9e-220  1
Pairwise Alignment 15 UNIPROT:Q8XFM6_SALTI Q8XFM6 Cell division protein FtsA.       2133  8.9e-220  1
Pairwise Alignment 16 UNIPROT:A4W6J7_9ENTR A4W6J7 Cell division protein FtsA.       2103  1.3e-216  1
Pairwise Alignment 17 UNIPROT:A0IS03_9ENTR A0IS03 Cell division protein FtsA.       2066  1.1e-212  1
Pairwise Alignment 18 UNIPROT:Q1C218_YERPA Q1C218 Cell division protein FtsA.       2053  2.7e-211  1
Pairwise Alignment 19 UNIPROT:Q1CMM3_YERPN Q1CMM3 Cell division protein FtsA.       2053  2.7e-211  1
Pairwise Alignment 20 UNIPROT:A1JJJ7_YERE8 A1JJJ7 Cell division protein FtsA.       2053  2.7e-211  1
Pairwise Alignment 21 UNIPROT:A4TQ79_YERPP A4TQ79 Cell division protein FtsA.       2053  2.7e-211  1
Pairwise Alignment 22 UNIPROT:Q66EK1_YERPS Q66EK1 Cell division protein FtsA.       2053  2.7e-211  1
Pairwise Alignment 23 UNIPROT:Q7CGB2_YERPE Q7CGB2 ATP-binding cell division pro...  2053  2.7e-211  1
Pairwise Alignment 24 UNIPROT:Q6D0I7_ERWCT Q6D0I7 Cell division protein.            2051  4.3e-211  1
Pairwise Alignment 25 UNIPROT:Q2NVU8_SODGM Q2NVU8 Cell division protein FtsA.       2022  5.1e-208  1
Pairwise Alignment 26 UNIPROT:Q0T8A3_SHIF8 Q0T8A3 ATP-binding cell division pro...  1992  7.7e-205  1
Pairwise Alignment 27 UNIPROT:Q7N151_PHOLL Q7N151 Cell division protein.            1992  7.7e-205  1
Pairwise Alignment 28 UNIPROT:A4K9G1_9ENTR A4K9G1 FtsA (Fragment).                  1944  9.4e-200  1
Pairwise Alignment 29 UNIPROT:A4K9G2_9ENTR A4K9G2 FtsA (Fragment).                  1942  1.5e-199  1
Pairwise Alignment 30 UNIPROT:A4K9G4_9ENTR A4K9G4 FtsA (Fragment).                  1937  5.2e-199  1
Pairwise Alignment 31 UNIPROT:A4K9G0_9ENTR A4K9G0 FtsA (Fragment).                  1934  1.1e-198  1
Pairwise Alignment 32 UNIPROT:A4K9G3_9ENTR A4K9G3 FtsA (Fragment).                  1925  9.7e-198  1
Pairwise Alignment 33 UNIPROT:Q493P8_BLOPB Q493P8 Cell division protein.            1767  5.4e-181  1
Pairwise Alignment 34 UNIPROT:Q1Z1K8_PHOPR Q1Z1K8 Putative cell division protei...  1673  4.9e-171  1
Pairwise Alignment 35 UNIPROT:Q7VQI5_BLOFL Q7VQI5 Cell division protein FtsA.       1672  6.3e-171  1
Pairwise Alignment 36 UNIPROT:Q6LMF9_PHOPR Q6LMF9 Putative cell division protei...  1663  5.7e-170  1
Pairwise Alignment 37 UNIPROT:Q2C3G3_9GAMM Q2C3G3 Cell division protein.            1660  1.2e-169  1
Pairwise Alignment 38 UNIPROT:Q8D2Z9_WIGBR Q8D2Z9 FtsA protein.                     1660  1.2e-169  1
Pairwise Alignment 39 UNIPROT:Q1ZNL2_9VIBR Q1ZNL2 Cell division protein.            1658  1.9e-169  1
Pairwise Alignment 40 UNIPROT:A4SI59_AERS4 A4SI59 Cell division protein FtsA.       1638  2.5e-167  1
Pairwise Alignment 41 UNIPROT:A0KPW9_AERHH A0KPW9 Cell division protein FtsA.       1637  3.2e-167  1
Pairwise Alignment 42 UNIPROT:A1F6C5_VIBCH A1F6C5 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 43 UNIPROT:A2PLR8_VIBCH A2PLR8 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 44 UNIPROT:A1EPD9_VIBCH A1EPD9 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 45 UNIPROT:A3GZA3_VIBCH A3GZA3 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 46 UNIPROT:A2P763_VIBCH A2P763 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 47 UNIPROT:A3EFN4_VIBCH A3EFN4 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 48 UNIPROT:A2PWX9_VIBCH A2PWX9 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 49 UNIPROT:A3EMN4_VIBCH A3EMN4 Cell division protein FtsA.       1578  5.7e-161  1
Pairwise Alignment 50 UNIPROT:A3GND0_VIBCH A3GND0 Cell division protein FtsA.       1578  5.7e-161  1

WARNING:  Descriptions of 1432 database sequences were not reported due to the
          limiting value of parameter V = 50.


>UNIPROT:FTSA_ECO57 P0ABH2 Cell division protein ftsA.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:FTSA_ECOL6 P0ABH1 Cell division protein ftsA.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:FTSA_ECOLI P0ABH0 Cell division protein ftsA.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:FTSA_SHIFL P0ABH3 Cell division protein ftsA.
        Length = 439

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q0TLP5_ECOL5 Q0TLP5 Cell division protein FtsA.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:A2ULK6_ECOLI A2ULK6 Cell division protein FtsA.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q1RGA1_ECOUT Q1RGA1 ATP-binding cell division protein, septation
            process, complexes with FtsZ, associated with junctions of inner
            and outer membranes.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q32JZ8_SHIDS Q32JZ8 ATP-binding cell division protein.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q3Z5R5_SHISS Q3Z5R5 ATP-binding cell division protein.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:A1A7D9_ECOK1 A1A7D9 Cell division protein.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q326E1_SHIBS Q326E1 ATP-binding cell division protein.
        Length = 420

 Score = 2140 (758.4 bits), Expect = 1.6e-220, P = 1.6e-220
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q5PDD3_SALPA Q5PDD3 Cell division protein FtsA.
        Length = 420

 Score = 2133 (755.9 bits), Expect = 8.9e-220, P = 8.9e-220
 Identities = 418/420 (99%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q57TC6_SALCH Q57TC6 ATP-binding cell division protein, septation
            process, complexes with FtsZ, associated with junctions of inner
            and outer membranes.
        Length = 420

 Score = 2133 (755.9 bits), Expect = 8.9e-220, P = 8.9e-220
 Identities = 418/420 (99%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q7CR80_SALTY Q7CR80 ATP-binding cell division protein.
        Length = 420

 Score = 2133 (755.9 bits), Expect = 8.9e-220, P = 8.9e-220
 Identities = 418/420 (99%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:Q8XFM6_SALTI Q8XFM6 Cell division protein FtsA.
        Length = 420

 Score = 2133 (755.9 bits), Expect = 8.9e-220, P = 8.9e-220
 Identities = 418/420 (99%), Positives = 420/420 (100%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420


>UNIPROT:A4W6J7_9ENTR A4W6J7 Cell division protein FtsA.
        Length = 418

 Score = 2103 (745.4 bits), Expect = 1.3e-216, P = 1.3e-216
 Identities = 413/420 (98%), Positives = 417/420 (99%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVNEEILQLQE+LRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA
Sbjct:   301 YTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GEAEVEKR   SVGSW+KRLNSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEAEVEKRT--SVGSWVKRLNSWLRKEF 418


>UNIPROT:A0IS03_9ENTR A0IS03 Cell division protein FtsA.
        Length = 418

 Score = 2066 (732.3 bits), Expect = 1.1e-212, P = 1.1e-212
 Identities = 402/420 (95%), Positives = 415/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GEAEVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEAEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:Q1C218_YERPA Q1C218 Cell division protein FtsA.
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:Q1CMM3_YERPN Q1CMM3 Cell division protein FtsA.
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:A1JJJ7_YERE8 A1JJJ7 Cell division protein FtsA.
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:A4TQ79_YERPP A4TQ79 Cell division protein FtsA.
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:Q66EK1_YERPS Q66EK1 Cell division protein FtsA.
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:Q7CGB2_YERPE Q7CGB2 ATP-binding cell division protein (Cell division
            protein FtsA).
        Length = 418

 Score = 2053 (727.8 bits), Expect = 2.7e-211, P = 2.7e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLA+SY+VLTEDERELGVCVVDIGGGTMD+AVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALGSIV KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQEPYYSTAVGLLHYGKESHL+GE+EVEKR  ASVG+W KR+NSWLRKEF
Sbjct:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGESEVEKR--ASVGNWFKRINSWLRKEF 418


>UNIPROT:Q6D0I7_ERWCT Q6D0I7 Cell division protein.
        Length = 418

 Score = 2051 (727.0 bits), Expect = 4.3e-211, P = 4.3e-211
 Identities = 399/420 (95%), Positives = 413/420 (98%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQ+DVE+VVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQDDVESVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALG+IVGKDE+VEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGAIVGKDENVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+E+LQLQE+LRQQGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG 
Sbjct:   301 YTELLNLVNDELLQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             P+NITGLTDYAQEPYYSTAVGLLHYGKESHL GE EVEKR  ASV +W KR+NSWLRKEF
Sbjct:   361 PMNITGLTDYAQEPYYSTAVGLLHYGKESHLGGEHEVEKR--ASVSNWFKRINSWLRKEF 418


>UNIPROT:Q2NVU8_SODGM Q2NVU8 Cell division protein FtsA.
        Length = 418

 Score = 2022 (716.8 bits), Expect = 5.1e-208, P = 5.1e-208
 Identities = 393/420 (93%), Positives = 407/420 (96%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIFAGLASSY+VLTEDERELGVCVVDIGGGTMD+AVYT GALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDMAVYTAGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP+DAEAIKVRHGCALG++V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPTDAEAIKVRHGCALGAVVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELLNLVN+EILQLQE+LR QGVKHHLAAGIVLTGGAAQI+GLAACAQRVFHTQVRIG 
Sbjct:   301 YTELLNLVNDEILQLQEQLRAQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQ PYYSTAVGLLHYGKESHL+GE +VEKR   SV +W KR + WLRKEF
Sbjct:   361 PLNITGLTDYAQAPYYSTAVGLLHYGKESHLSGEVDVEKRT--SVSTWFKRFSGWLRKEF 418


>UNIPROT:Q0T8A3_SHIF8 Q0T8A3 ATP-binding cell division protein.
        Length = 389

 Score = 1992 (706.3 bits), Expect = 7.7e-205, P = 7.7e-205
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query:    32 MVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQ 91
             MVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQ
Sbjct:     1 MVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQ 60

Query:    92 NEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSG 151
             NEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSG
Sbjct:    61 NEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSG 120

Query:   152 VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDI 211
             VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDI
Sbjct:   121 VRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDI 180

Query:   212 GGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGK 271
             GGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGK
Sbjct:   181 GGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGK 240

Query:   272 DESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAG 331
             DESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAG
Sbjct:   241 DESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAG 300

Query:   332 IVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHL 391
             IVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHL
Sbjct:   301 IVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHL 360

Query:   392 NGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             NGEAEVEKRVTASVGSWIKRLNSWLRKEF
Sbjct:   361 NGEAEVEKRVTASVGSWIKRLNSWLRKEF 389


>UNIPROT:Q7N151_PHOLL Q7N151 Cell division protein.
        Length = 418

 Score = 1992 (706.3 bits), Expect = 7.7e-205, P = 7.7e-205
 Identities = 384/420 (91%), Positives = 405/420 (96%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIK+TDRKLVVGLEIGTAKV+ALVGE+LPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
Sbjct:     1 MIKSTDRKLVVGLEIGTAKVSALVGEILPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDV+NVVHTAKSVR
Sbjct:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVDNVVHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDE+R+LHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNI KAVERCGL
Sbjct:   121 VRDEYRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIAKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVDQLIF+GLA+SY+VLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT
Sbjct:   181 KVDQLIFSGLAASYAVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPPSDAE IKVRHGCALGS+V KDESVEVPSVGGRPPRSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPSDAETIKVRHGCALGSLVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y ELLNLVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GLA CAQRVFH QVRIG 
Sbjct:   301 YIELLNLVNDEILRLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLAECAQRVFHAQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PLNITGLTDYAQ+PYYSTAVGLLHYGK SHLNG+A++EK V  SV  W KR++SWL+KEF
Sbjct:   361 PLNITGLTDYAQQPYYSTAVGLLHYGKASHLNGDADIEKHV--SVSRWFKRVSSWLKKEF 418


>UNIPROT:A4K9G1_9ENTR A4K9G1 FtsA (Fragment).
        Length = 412

 Score = 1944 (689.4 bits), Expect = 9.4e-200, P = 9.4e-200
 Identities = 374/414 (90%), Positives = 397/414 (95%)

Query:     7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66
             RKLVVGLEIGT+KV+ALVGE+L DGMVNIIGVG+CPSRGMDKGGVNDLESVVKCVQRAID
Sbjct:     1 RKLVVGLEIGTSKVSALVGEILSDGMVNIIGVGNCPSRGMDKGGVNDLESVVKCVQRAID 60

Query:    67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126
             QAELMADCQ+SSVYLALSGKH+SCQNEIGMVPISE+EVTQ+DV +VVHTAKSVRVRDEHR
Sbjct:    61 QAELMADCQMSSVYLALSGKHVSCQNEIGMVPISEDEVTQDDVGSVVHTAKSVRVRDEHR 120

Query:   127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186
             +LHV+PQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI
Sbjct:   121 ILHVMPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 180

Query:   187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246
             FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA
Sbjct:   181 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 240

Query:   247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306
             FGTPPSDAE IKVRHGCALG+IV KDE+VEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN
Sbjct:   241 FGTPPSDAETIKVRHGCALGTIVSKDENVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 300

Query:   307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366
             LVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GL  CAQRVFHTQVRIG PLNITG
Sbjct:   301 LVNDEILKLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLVKCAQRVFHTQVRIGKPLNITG 360

Query:   367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             LTDYAQEPYYSTAVGLLHYGK++HL  EAE++KR   SV SW  ++ SWLRKEF
Sbjct:   361 LTDYAQEPYYSTAVGLLHYGKQTHLGNEAEMDKRT--SVSSWFHKITSWLRKEF 412


>UNIPROT:A4K9G2_9ENTR A4K9G2 FtsA (Fragment).
        Length = 412

 Score = 1942 (688.7 bits), Expect = 1.5e-199, P = 1.5e-199
 Identities = 372/414 (89%), Positives = 398/414 (96%)

Query:     7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66
             RKLVVGLEIGT+KV+ALVGE+L DGMVNIIGVG+CPSRGMDKGGVNDLESVVKCVQRAID
Sbjct:     1 RKLVVGLEIGTSKVSALVGEILSDGMVNIIGVGNCPSRGMDKGGVNDLESVVKCVQRAID 60

Query:    67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126
             QAELMADCQ+SSVYLALSGKH+SCQNEIGMVPISE+EVTQ+DV++VVHTAKSVRVRDEHR
Sbjct:    61 QAELMADCQMSSVYLALSGKHVSCQNEIGMVPISEDEVTQDDVDSVVHTAKSVRVRDEHR 120

Query:   127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186
             +LHV+PQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKN+VKAVERCGLKVDQLI
Sbjct:   121 ILHVMPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNMVKAVERCGLKVDQLI 180

Query:   187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246
             FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA
Sbjct:   181 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 240

Query:   247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306
             FGTPPSDAE IKVRHGCALG+IV KDE+VEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN
Sbjct:   241 FGTPPSDAETIKVRHGCALGTIVSKDENVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 300

Query:   307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366
             LVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GL  CAQRVFHTQVRIG PLNITG
Sbjct:   301 LVNDEILKLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLVKCAQRVFHTQVRIGKPLNITG 360

Query:   367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             LTDYAQEPYYSTAVGLLHYGK++HL  EAE++KR   SV SW  ++ SWL+KEF
Sbjct:   361 LTDYAQEPYYSTAVGLLHYGKQTHLGNEAEMDKRT--SVSSWFHKITSWLKKEF 412


>UNIPROT:A4K9G4_9ENTR A4K9G4 FtsA (Fragment).
        Length = 412

 Score = 1937 (686.9 bits), Expect = 5.2e-199, P = 5.2e-199
 Identities = 372/414 (89%), Positives = 396/414 (95%)

Query:     7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66
             RKLVVGLEIGT+KV+ALVGE+L DGMVNIIGVG+CPSRGMDKGGVNDLESVVKCVQRAID
Sbjct:     1 RKLVVGLEIGTSKVSALVGEILSDGMVNIIGVGNCPSRGMDKGGVNDLESVVKCVQRAID 60

Query:    67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126
             QAELMADCQ+SSVYLALSGKH+SCQNEIGMVPISE+EVTQ+DV++VVHTAKSVRVRDEHR
Sbjct:    61 QAELMADCQMSSVYLALSGKHVSCQNEIGMVPISEDEVTQDDVDSVVHTAKSVRVRDEHR 120

Query:   127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186
             +LHV+PQEYAIDYQEGIKNPVGL GVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI
Sbjct:   121 ILHVMPQEYAIDYQEGIKNPVGLPGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 180

Query:   187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246
             FAGLASSYSVLTEDERE GVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA
Sbjct:   181 FAGLASSYSVLTEDEREWGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 240

Query:   247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306
             FGTPPSDAE IKVRHGCALG+IV KDE+VEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN
Sbjct:   241 FGTPPSDAETIKVRHGCALGTIVSKDENVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 300

Query:   307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366
             LVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GL  CAQRVFHTQVRIG PLNITG
Sbjct:   301 LVNDEILKLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLVKCAQRVFHTQVRIGKPLNITG 360

Query:   367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             LTDYAQEPYYSTAVGLLHYGK++HL  EAE++KR   SV SW  ++ SWLRKEF
Sbjct:   361 LTDYAQEPYYSTAVGLLHYGKQTHLGNEAEMDKRT--SVSSWFHKITSWLRKEF 412


>UNIPROT:A4K9G0_9ENTR A4K9G0 FtsA (Fragment).
        Length = 412

 Score = 1934 (685.9 bits), Expect = 1.1e-198, P = 1.1e-198
 Identities = 371/414 (89%), Positives = 396/414 (95%)

Query:     7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66
             RKLVVGLEIGT+KV+ALVGE+L DGMVNIIGVG+CPSRGMDKGGVNDLESVVKCVQRAID
Sbjct:     1 RKLVVGLEIGTSKVSALVGEILSDGMVNIIGVGNCPSRGMDKGGVNDLESVVKCVQRAID 60

Query:    67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126
             QAELMADCQ+SSVYLALSGKH+SCQNEIGMVPISE+EVTQ+DV++VVHTAKSVRVRDEHR
Sbjct:    61 QAELMADCQMSSVYLALSGKHVSCQNEIGMVPISEDEVTQDDVDSVVHTAKSVRVRDEHR 120

Query:   127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186
             +LHV+PQEYAIDYQEGIKNPVGL GVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI
Sbjct:   121 ILHVMPQEYAIDYQEGIKNPVGLPGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 180

Query:   187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246
             FAGLASSYSVLTEDERELGVCVVD+GGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA
Sbjct:   181 FAGLASSYSVLTEDERELGVCVVDMGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 240

Query:   247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306
              GTPPSDAE IKVRHGCALG+IV KDE+VEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN
Sbjct:   241 LGTPPSDAETIKVRHGCALGTIVSKDENVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 300

Query:   307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366
             LVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GL  CAQRVFHTQVRIG PLNITG
Sbjct:   301 LVNDEILKLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLVKCAQRVFHTQVRIGKPLNITG 360

Query:   367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             LTDYAQEPYYSTAVGLLHYGK++HL  EAE++KR   SV SW  ++ SWLRKEF
Sbjct:   361 LTDYAQEPYYSTAVGLLHYGKQTHLGNEAEMDKRT--SVSSWFHKITSWLRKEF 412


>UNIPROT:A4K9G3_9ENTR A4K9G3 FtsA (Fragment).
        Length = 412

 Score = 1925 (682.7 bits), Expect = 9.7e-198, P = 9.7e-198
 Identities = 369/414 (89%), Positives = 396/414 (95%)

Query:     7 RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAID 66
             RKLVVGLEIGT KV+ALVGE+L DGMVNIIGVG+CPSRGMDKGGVNDLESVVKCVQRAID
Sbjct:     1 RKLVVGLEIGTFKVSALVGEILSDGMVNIIGVGNCPSRGMDKGGVNDLESVVKCVQRAID 60

Query:    67 QAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHR 126
             QAELMADCQ+SSVYLALSGKH+SCQNEIGMVPISE+EVTQ+DV++VVHTAKSVRVRDEHR
Sbjct:    61 QAELMADCQMSSVYLALSGKHVSCQNEIGMVPISEDEVTQDDVDSVVHTAKSVRVRDEHR 120

Query:   127 VLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLI 186
             +LHV+PQEYAI+YQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIV A+ERCGLKVDQLI
Sbjct:   121 ILHVMPQEYAINYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVTALERCGLKVDQLI 180

Query:   187 FAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 246
             FAGLASSYSVLTE+ERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA
Sbjct:   181 FAGLASSYSVLTEBERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYA 240

Query:   247 FGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 306
             FGTPPSDAE IKVRHGCALG+IV KDE+VEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN
Sbjct:   241 FGTPPSDAETIKVRHGCALGTIVSKDENVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLN 300

Query:   307 LVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITG 366
             LVN+EIL+LQE+LRQQGVKHHLAAGIVLTGG AQI+GL  CAQRVFHTQVRIG PLNITG
Sbjct:   301 LVNDEILKLQEQLRQQGVKHHLAAGIVLTGGGAQIDGLVKCAQRVFHTQVRIGKPLNITG 360

Query:   367 LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             LTDYAQEPYYSTAVGLLHYGK++HL  EAE++KR   SV SW  ++ SWL+KEF
Sbjct:   361 LTDYAQEPYYSTAVGLLHYGKQTHLGNEAEMDKRT--SVSSWFHKITSWLQKEF 412


>UNIPROT:Q493P8_BLOPB Q493P8 Cell division protein.
        Length = 418

 Score = 1767 (627.1 bits), Expect = 5.4e-181, P = 5.4e-181
 Identities = 331/420 (78%), Positives = 384/420 (91%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             MIKA+D+KL+VGLEIGTAKVA ++GE+LPDG+VN+IG+G CPSRGMDKGGVN+LESV+KC
Sbjct:     1 MIKASDKKLLVGLEIGTAKVATMIGEILPDGIVNVIGLGYCPSRGMDKGGVNNLESVIKC 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQ +I+QAELMA CQISSVYL+LSGKHISC+NEIGMVPISEEEVTQ DV+NVVH AKSVR
Sbjct:    61 VQYSINQAELMAGCQISSVYLSLSGKHISCKNEIGMVPISEEEVTQSDVDNVVHIAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             VRDEHR+LHVIPQ+YAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
Sbjct:   121 VRDEHRILHVIPQDYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             +VDQLIF+GLASS++VLTEDERELGVCVVD+GGGTMDIA+YT GALRHTKVIPYAGNVVT
Sbjct:   181 QVDQLIFSGLASSHAVLTEDERELGVCVVDLGGGTMDIAIYTAGALRHTKVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTP SDAE IKVR+GCAL S++ K E++EVPSVGGRPPR LQR  LAE+IEPR
Sbjct:   241 SDIAYAFGTPLSDAEIIKVRYGCALESLISKGENIEVPSVGGRPPRILQRHMLAEIIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y EL+ LVN+EILQLQ +LRQ  +KHHLAAGIVLTGGA+ I+GL+ACAQ+VFHTQVRI +
Sbjct:   301 YIELMMLVNKEILQLQSQLRQLNIKHHLAAGIVLTGGASLIDGLSACAQKVFHTQVRIAS 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
              +N  G+TD  + P+YST +GLLHYGKESHLN E ++EK +T  +  WI+++N+WL+KEF
Sbjct:   361 SINTNGVTDDIKRPHYSTVIGLLHYGKESHLNNEVDIEKGIT--IKGWIRKVNNWLKKEF 418


>UNIPROT:Q1Z1K8_PHOPR Q1Z1K8 Putative cell division protein FtsA.
        Length = 418

 Score = 1673 (594.0 bits), Expect = 4.9e-171, P = 4.9e-171
 Identities = 315/420 (75%), Positives = 369/420 (87%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M KA D+KL+VGL+IGT+KV ALVGEVLPDG VN+IGVGS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKAADKKLIVGLDIGTSKVCALVGEVLPDGNVNVIGVGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRA+DQAELMADCQISSVYL+LSGKHISCQ E GMVPIS++EVTQ+DV+NV+HTAKSV+
Sbjct:    61 VQRAVDQAELMADCQISSVYLSLSGKHISCQTEKGMVPISDKEVTQDDVDNVIHTAKSVK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DEHR LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMA+NIVKAVERCGL
Sbjct:   121 ISDEHRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMARNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVD LIF+GLA+S++VLT DERELGVCVVDIGGGTMD+AV++GGALRH +VIPYAGNVVT
Sbjct:   181 KVDHLIFSGLAASHAVLTPDERELGVCVVDIGGGTMDLAVWSGGALRHAEVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP DAE IKV++GCAL  +V KD  V+VPSVGGRP RSLQ QTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPGDAEEIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y+ELL LVN++++ +Q+++R  GVKHHLAAGIVLTGGA+Q+EGL  CA+RVF  QVRIG 
Sbjct:   301 YSELLGLVNQKLIDIQDQMRDAGVKHHLAAGIVLTGGASQMEGLIECAERVFRNQVRIGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL + GLTDY Q P+++TAVGLLHYGK+S    ++++E +   SV     R++ W +KEF
Sbjct:   361 PLELNGLTDYVQAPHFATAVGLLHYGKDSQAFDDSDIEPK--RSVSGLFTRISGWFKKEF 418


>UNIPROT:Q7VQI5_BLOFL Q7VQI5 Cell division protein FtsA.
        Length = 420

 Score = 1672 (593.6 bits), Expect = 6.3e-171, P = 6.3e-171
 Identities = 313/422 (74%), Positives = 377/422 (89%)

Query:     1 MIKATD-RKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVK 59
             MIK +D +KL+VGLEIGTAKVA L+GE+LPD M+NIIG+G C S+GMDKGGVN+LESV+K
Sbjct:     1 MIKVSDNKKLLVGLEIGTAKVATLIGEILPDSMINIIGMGCCASQGMDKGGVNNLESVIK 60

Query:    60 CVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSV 119
             CV+ +I+QAE M+ CQI+SVYL+LSGKHISC+NEIGMV ISEEEVTQ DV+NVVH AKSV
Sbjct:    61 CVEYSINQAESMSGCQITSVYLSLSGKHISCKNEIGMVSISEEEVTQSDVDNVVHIAKSV 120

Query:   120 RVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 179
             ++ DEHR+LHVIPQ+Y+IDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG
Sbjct:   121 KMSDEHRILHVIPQDYSIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCG 180

Query:   180 LKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV 239
             L+VDQLIF+GL+SSY+VLT+DERELGVCVVD+GGGTMDIA+YT GALR+ KVIPYAGNVV
Sbjct:   181 LRVDQLIFSGLSSSYAVLTQDERELGVCVVDLGGGTMDIAIYTAGALRYIKVIPYAGNVV 240

Query:   240 TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEP 299
             TSDIAYAFGTP S AE+IK+R+GCAL S+V +DE++EVPSVGGRPPR LQR  LAE+IEP
Sbjct:   241 TSDIAYAFGTPLSAAESIKLRYGCALESLVDRDENIEVPSVGGRPPRILQRYMLAEIIEP 300

Query:   300 RYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIG 359
             RY EL+NLVN+EILQLQ +L+Q  +KHHLAAG+VLTGGA+ I+GL ACAQ+VFH QVRI 
Sbjct:   301 RYVELMNLVNKEILQLQSQLKQFNIKHHLAAGVVLTGGASMIDGLVACAQKVFHNQVRIA 360

Query:   360 APLNITG-LTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRK 418
             + +NI G + D  + P YST +GLLHYGKESHLN +A+++K++   + +WIK++N WL+K
Sbjct:   361 SSINILGSIDDDIRGPQYSTVIGLLHYGKESHLNDDADIDKKI--KIKNWIKKINGWLKK 418

Query:   419 EF 420
             EF
Sbjct:   419 EF 420


>UNIPROT:Q6LMF9_PHOPR Q6LMF9 Putative cell division protein FtsA.
        Length = 418

 Score = 1663 (590.5 bits), Expect = 5.7e-170, P = 5.7e-170
 Identities = 314/420 (74%), Positives = 368/420 (87%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M KA D+KL+VGL+IGT+KV ALVGEVLPDG VN+IGVGS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKAADKKLIVGLDIGTSKVCALVGEVLPDGNVNVIGVGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRA+DQAELMADCQISSVYL+LSGKHISCQ E GMVPIS++EVTQ+DV+NV+HTAKSV+
Sbjct:    61 VQRAVDQAELMADCQISSVYLSLSGKHISCQTEKGMVPISDKEVTQDDVDNVIHTAKSVK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DEHR LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMA+NIVKAVERCGL
Sbjct:   121 ISDEHRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMARNIVKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVD LIF+GLA+S++VLT DERELGVCVVDIGGGTMD+AV++GGALRH +VIPYAGNVVT
Sbjct:   181 KVDHLIFSGLAASHAVLTPDERELGVCVVDIGGGTMDLAVWSGGALRHAEVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTP  DAE IKV++GCAL  +V KD  V+VPSVGGRP RSLQ QTLAEVIEPR
Sbjct:   241 SDIAYAFGTPLGDAEEIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y+ELL LVN++++ +Q+++R  GVKHHLAAGIVLTGGA+Q+EGL  CA+RVF  QVRIG 
Sbjct:   301 YSELLGLVNQKLIDIQDQMRDAGVKHHLAAGIVLTGGASQMEGLIECAERVFRNQVRIGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL + GLTDY Q P+++TAVGLLHYGK+S    ++++E +   SV     R++ W +KEF
Sbjct:   361 PLELNGLTDYVQAPHFATAVGLLHYGKDSQAFDDSDIEPK--RSVSGLFARISGWFKKEF 418


>UNIPROT:Q2C3G3_9GAMM Q2C3G3 Cell division protein.
        Length = 418

 Score = 1660 (589.4 bits), Expect = 1.2e-169, P = 1.2e-169
 Identities = 319/420 (75%), Positives = 367/420 (87%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M KA D+KL+VGL+IGT++V ALVGEVLPD  VN+IG+GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKAADQKLIVGLDIGTSEVTALVGEVLPDNTVNVIGMGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRA+D+AELMA+CQISSVYL+LSGKHISCQ E GMVPISE+EVTQ+DV+NV+HTAKSV+
Sbjct:    61 VQRAVDKAELMAECQISSVYLSLSGKHISCQTEKGMVPISEKEVTQDDVDNVIHTAKSVK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DE R LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMAKNIVKAVERC L
Sbjct:   121 LSDEQRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMAKNIVKAVERCDL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVD LIF+GLASSY+VLT DERELGVCVVDIGGGTMD+A+++GGALRH +VIPYAGNVVT
Sbjct:   181 KVDHLIFSGLASSYAVLTPDERELGVCVVDIGGGTMDLAIWSGGALRHAEVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP DAE IKV++GCAL  +V KD  V+VPSVGGRP RSLQ QTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPGDAEDIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y+ELL LVN+++L +QE+LR+ GVKHHLAAGIVLTGGAAQ+EGL  CA+RVF  QVRIG 
Sbjct:   301 YSELLGLVNQKLLTVQEQLREAGVKHHLAAGIVLTGGAAQMEGLTECAERVFRHQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY Q P Y+TAVGLLHYGK+S    E E+E +   SV     R++ WL+KEF
Sbjct:   361 PLELSGLTDYVQAPTYATAVGLLHYGKDSQSFDENELEPK--RSVTGLFSRISGWLKKEF 418


>UNIPROT:Q8D2Z9_WIGBR Q8D2Z9 FtsA protein.
        Length = 418

 Score = 1660 (589.4 bits), Expect = 1.2e-169, P = 1.2e-169
 Identities = 307/420 (73%), Positives = 375/420 (89%)

Query:     2 IKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCV 61
             +KATD+KLVVGLEIGT+KVA LVG++L DG+V IIG G+ PS+G+DKGGVNDLE+VV+CV
Sbjct:     1 MKATDKKLVVGLEIGTSKVAVLVGDILQDGIVKIIGYGNYPSKGIDKGGVNDLEAVVQCV 60

Query:    62 QRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRV 121
             Q++I+QAEL ++C I SVYLALSGKHISCQNEIG+VPI EEEVTQEDVENVVHTAKSVR+
Sbjct:    61 QQSINQAELTSECNIKSVYLALSGKHISCQNEIGIVPIPEEEVTQEDVENVVHTAKSVRI 120

Query:   122 RDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLK 181
             ++EHR+LHVIPQEY IDYQEGIKNP+GLSG+RMQA VHLITCHN MAKN++KAV RC +K
Sbjct:   121 KNEHRILHVIPQEYTIDYQEGIKNPIGLSGIRMQASVHLITCHNGMAKNMIKAVRRCDVK 180

Query:   182 VDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTS 241
             VDQ+IF+GLASSY+VLTEDE+ELGVCVVDIGGGTMDIA+YT GALRHTKVIPYAGNVVT 
Sbjct:   181 VDQVIFSGLASSYAVLTEDEKELGVCVVDIGGGTMDIAIYTAGALRHTKVIPYAGNVVTR 240

Query:   242 DIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRY 301
             DIAYAFGTPP +AE+IK+ +GCALGS+V K+E++E+ S+GGRP R LQRQTL+EVIEPRY
Sbjct:   241 DIAYAFGTPPIEAESIKINYGCALGSLVKKEENIEIASLGGRPSRILQRQTLSEVIEPRY 300

Query:   302 TELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAP 361
              ELLNLV +E+ +LQ++L+ + +KHHL+AGIVLTGGA+QI G+ +CAQ++F+TQVRIG P
Sbjct:   301 IELLNLVKKEVCKLQKQLKSESIKHHLSAGIVLTGGASQINGIISCAQKIFNTQVRIGEP 360

Query:   362 LNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAE-VEKRVTASVGSWIKRLNSWLRKEF 420
             LN+TGL DY+  PYY+TAVGLLHYGKE  LN E E +EK     + +WIK+ ++W++KEF
Sbjct:   361 LNVTGLIDYSNHPYYATAVGLLHYGKEYFLNKEIESMEKN--NFIENWIKKFSNWIKKEF 418


>UNIPROT:Q1ZNL2_9VIBR Q1ZNL2 Cell division protein.
        Length = 418

 Score = 1658 (588.7 bits), Expect = 1.9e-169, P = 1.9e-169
 Identities = 319/420 (75%), Positives = 366/420 (87%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M KA D+KL+VGL+IGT++V ALVGEVLPD  VN+IG+GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKAADQKLIVGLDIGTSEVTALVGEVLPDNTVNVIGMGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRA+D+AELMA+CQISSVYL+LSGKHISCQ E GMVPISE+EVTQ+DV+NV+HTAKSV+
Sbjct:    61 VQRAVDKAELMAECQISSVYLSLSGKHISCQTEKGMVPISEKEVTQDDVDNVIHTAKSVK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DE R LHVIPQE+AIDYQEGIKNPVGLSGVRM+A VHLITCHNDMAKNIVKAVERC L
Sbjct:   121 LSDEQRTLHVIPQEFAIDYQEGIKNPVGLSGVRMEASVHLITCHNDMAKNIVKAVERCDL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KVD LIF+GLASSY+VLT DERELGVCVVDIGGGTMD+A+++GGALRH  VIPYAGNVVT
Sbjct:   181 KVDHLIFSGLASSYAVLTPDERELGVCVVDIGGGTMDLAIWSGGALRHAAVIPYAGNVVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP DAE IKV++GCAL  +V KD  V+VPSVGGRP RSLQ QTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPGDAEDIKVKYGCALSELVSKDAKVDVPSVGGRPSRSLQSQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             Y+ELL LVN+++L +QE+LR+ GVKHHLAAGIVLTGGAAQ+EGL  CA+RVF  QVRIG 
Sbjct:   301 YSELLGLVNQKLLTVQEQLREAGVKHHLAAGIVLTGGAAQMEGLTECAERVFRHQVRIGQ 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY Q P Y+TAVGLLHYGK+S    E E+E +   SV     R++ WL+KEF
Sbjct:   361 PLELSGLTDYVQAPTYATAVGLLHYGKDSQSFDENELEPK--RSVTGLFSRISGWLKKEF 418


>UNIPROT:A4SI59_AERS4 A4SI59 Cell division protein FtsA.
        Length = 419

 Score = 1638 (581.7 bits), Expect = 2.5e-167, P = 2.5e-167
 Identities = 308/420 (73%), Positives = 370/420 (88%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  DR L+VGL+IGT KVA LVGEVLPDG +N+IG+GS  SRGMDKGGVNDL+SVVK 
Sbjct:     1 MTKTADRNLIVGLDIGTTKVAVLVGEVLPDGELNVIGMGSHASRGMDKGGVNDLDSVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             ++RA+++AE+MADCQISSVYL LSGKHI C+NE GMVPIS+EEVTQEDV+NV+HTAKSVR
Sbjct:    61 LRRAVEEAEMMADCQISSVYLGLSGKHIDCRNETGMVPISDEEVTQEDVDNVIHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DE RVLHV+PQE+AIDYQEGIKNPVGLSGVRM AKVHLITCHNDMA+NI K VE+ GL
Sbjct:   121 LSDELRVLHVLPQEFAIDYQEGIKNPVGLSGVRMAAKVHLITCHNDMARNIEKCVEKVGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             +VDQLIF+ LASSY+VLTEDE+ELGVCVVDIGGGTMD++++TGGALRHTKVIPYAG+ VT
Sbjct:   181 RVDQLIFSALASSYAVLTEDEKELGVCVVDIGGGTMDMSLFTGGALRHTKVIPYAGSTVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP DAEAIKVR+GCALG +V K++++EVPSVGGRP RSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPLDAEAIKVRYGCALGRLVSKEDNIEVPSVGGRPARSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELL++VN+E++++Q +L+ QGVKH LAAG+VLTGGAAQIEG+  CA+++F +QVR+G 
Sbjct:   301 YTELLSMVNDELVRVQSELKAQGVKHQLAAGVVLTGGAAQIEGIVECAEQIFQSQVRVGE 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             P+NI GL+DY Q P YSTAVGLL YG+    +G ++ E    ASVG  +KR+++WLR EF
Sbjct:   361 PMNIRGLSDYVQAPVYSTAVGLLQYGRTHQSSGSSK-EYAAKASVGGLVKRVSNWLRGEF 419


>UNIPROT:A0KPW9_AERHH A0KPW9 Cell division protein FtsA.
        Length = 419

 Score = 1637 (581.3 bits), Expect = 3.2e-167, P = 3.2e-167
 Identities = 308/420 (73%), Positives = 369/420 (87%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  DR L+VGL+IGT KVA LVGEVLPDG +N+IG+GS  SRGMDKGGVNDL+SVVK 
Sbjct:     1 MTKTADRNLIVGLDIGTTKVAVLVGEVLPDGELNVIGMGSHASRGMDKGGVNDLDSVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             ++RA+++AE+MADCQISSVYL LSGKHI C+NE GMVPIS+EEVTQEDV+NV+HTAKSVR
Sbjct:    61 LRRAVEEAEMMADCQISSVYLGLSGKHIDCRNETGMVPISDEEVTQEDVDNVIHTAKSVR 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + DE RVLHV+PQE+AIDYQEGIKNPVGLSGVRM AKVHLITCHNDMA+NI K VE+ GL
Sbjct:   121 LSDELRVLHVLPQEFAIDYQEGIKNPVGLSGVRMAAKVHLITCHNDMARNIEKCVEKVGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             +VDQLIF+ LASSY+VLTEDE+ELGVCVVDIGGGTMD++++TGGALRHTKVIPYAG+ VT
Sbjct:   181 RVDQLIFSALASSYAVLTEDEKELGVCVVDIGGGTMDMSLFTGGALRHTKVIPYAGSTVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIAYAFGTPP DAEAIKVR+GCALG +V K++++EVPSVGGRP RSLQRQTLAEVIEPR
Sbjct:   241 SDIAYAFGTPPLDAEAIKVRYGCALGRLVSKEDNIEVPSVGGRPARSLQRQTLAEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTELL++VN+E++++Q +L+ QGVKH LAAG+VLTGGAAQIEG+  CA+++F +QVR+G 
Sbjct:   301 YTELLSMVNDELVRVQSELKAQGVKHQLAAGVVLTGGAAQIEGIVECAEQIFQSQVRVGE 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             P+NI GL+DY Q P YSTAVGLL YG+     G ++ E    ASVG  +KR+++WLR EF
Sbjct:   361 PMNIRGLSDYVQAPVYSTAVGLLQYGRTHQSTGSSK-EYAAKASVGGLVKRVSNWLRGEF 419


>UNIPROT:A1F6C5_VIBCH A1F6C5 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A2PLR8_VIBCH A2PLR8 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A1EPD9_VIBCH A1EPD9 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A3GZA3_VIBCH A3GZA3 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A2P763_VIBCH A2P763 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A3EFN4_VIBCH A3EFN4 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A2PWX9_VIBCH A2PWX9 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A3EMN4_VIBCH A3EMN4 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420


>UNIPROT:A3GND0_VIBCH A3GND0 Cell division protein FtsA.
        Length = 420

 Score = 1578 (560.5 bits), Expect = 5.7e-161, P = 5.7e-161
 Identities = 289/420 (68%), Positives = 361/420 (85%)

Query:     1 MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC 60
             M K  D  ++VGL+IGTA V+ALVGE+LPDG +NIIG GS PSRGMDKGGVNDLESVVK 
Sbjct:     1 MTKTVDDNIIVGLDIGTATVSALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKS 60

Query:    61 VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR 120
             VQRAIDQAE+MA+C+IS V+L++SG+HI+ + E GM  IS+EEV+QED++  +HTAKS++
Sbjct:    61 VQRAIDQAEMMAECKISHVFLSISGRHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIK 120

Query:   121 VRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL 180
             + +E R+LHVIPQE+ IDYQEGIKNP+GLSGVRM+  VHLITCHNDMA+NI+KAVERCGL
Sbjct:   121 IGEEQRILHVIPQEFTIDYQEGIKNPLGLSGVRMEVSVHLITCHNDMARNIIKAVERCGL 180

Query:   181 KVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVT 240
             KV+QL+++GLA+S +V+TEDERELGVCVVDIG GTMDIA++TGGALRHT+V  YAGN VT
Sbjct:   181 KVEQLVYSGLAASNAVITEDERELGVCVVDIGAGTMDIAIWTGGALRHTEVFSYAGNAVT 240

Query:   241 SDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPR 300
             SDIA+AFGTP SDAE IKV++GCAL  +V KD++V VPSVGGRP RSLQRQTL+EVIEPR
Sbjct:   241 SDIAFAFGTPVSDAEEIKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPR 300

Query:   301 YTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGA 360
             YTEL+ LVN+ +  +QE LR++G+KHHLAAG+VLTGGAAQIEGL ACA+RVF  QVR+G 
Sbjct:   301 YTELMGLVNQTVDSVQESLRKEGIKHHLAAGVVLTGGAAQIEGLVACAERVFRNQVRVGK 360

Query:   361 PLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF 420
             PL ++GLTDY +EPY+STAVGLLHY ++S ++ + E ++    S+  WI RL +W++KEF
Sbjct:   361 PLEVSGLTDYVKEPYHSTAVGLLHYARDSQISDDTEYQEPKRPSMTGWIGRLRNWIQKEF 420

WARNING:  HSPs involving 1432 database sequences were not reported due to the
          limiting value of parameter B = 50.


Parameters:
  E=10
  B=50
  V=50
  mformat="7,/ebi/extserv/blast-work/interactive/blast-20070625-13181643_app.xml"
  mformat=1
  matrix=BLOSUM62
  sump
  echofilter
  filter=none
  cpus=8
  sort_by_pvalue
  putenv="WUBLASTMAT=/ebi/extserv/bin/wu-blast/matrix"
  putenv="WUBLASTDB=/ebi/services/idata/v1881/blastdb"
  putenv="WUBLASTFILTER=/ebi/extserv/bin/wu-blast/filter"

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.317   0.135   0.386    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W   T  X   E2     S2
   +0      0      420       420       8.1  90 3  11 22  0.41    34
                                                    34  0.45    37


Statistics:

  Database:  /ebi/services/idata/v1881/blastdb/uniprot
   Title:  uniprot
   Posted:  11:40:17 PM BST Jun 11, 2007
   Created:  11:40:15 PM BST Jun 11, 2007
   Format:  XDF-1
   # of letters in database:  1,558,448,118
   # of sequences in database:  4,739,517
   # of database sequences satisfying E:  1482
  No. of states in DFA:  607 (129 KB)
  Total size of DFA:  444 KB (2177 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  8
  Search cpu time:  275.76u 1.90s 277.66t   Elapsed:  00:00:41
  Total cpu time:  275.77u 1.90s 277.67t   Elapsed:  00:00:41
  Start:  Mon Jun 25 13:18:17 2007   End:  Mon Jun 25 13:18:58 2007
WARNINGS ISSUED:  2
spacer
spacer